Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3077523..3078001 Replicon chromosome
Accession NZ_CP114128
Organism Escherichia coli strain PE164

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag LZG51_RS15195 Protein ID WP_001303876.1
Coordinates 3077714..3078001 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag LZG51_RS15190 Protein ID WP_000536233.1
Coordinates 3077523..3077714 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LZG51_RS15155 (3072909) 3072909..3073679 - 771 WP_000450992.1 DUF1627 domain-containing protein -
LZG51_RS15160 (3073761) 3073761..3074447 - 687 WP_000788749.1 ATP-binding protein -
LZG51_RS15165 (3074454) 3074454..3075563 - 1110 WP_153645676.1 DNA-binding protein -
LZG51_RS15170 (3075642) 3075642..3076097 + 456 WP_000273724.1 hypothetical protein -
LZG51_RS15175 (3076304) 3076304..3076729 - 426 WP_000693855.1 toxin YdaT family protein -
LZG51_RS15180 (3076713) 3076713..3076985 - 273 WP_000887453.1 YdaS family helix-turn-helix protein -
LZG51_RS15185 (3077094) 3077094..3077495 + 402 WP_153645675.1 helix-turn-helix domain-containing protein -
LZG51_RS15190 (3077523) 3077523..3077714 + 192 WP_000536233.1 hypothetical protein Antitoxin
LZG51_RS15195 (3077714) 3077714..3078001 + 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LZG51_RS15200 (3078278) 3078278..3078433 + 156 WP_000379575.1 DUF1391 family protein -
LZG51_RS15205 (3078538) 3078538..3079751 + 1214 WP_170872721.1 IS3 family transposase -
LZG51_RS15210 (3079790) 3079790..3079876 + 87 Protein_2979 protein YdfB -
LZG51_RS15215 (3079888) 3079888..3080277 + 390 WP_153645614.1 hypothetical protein -
LZG51_RS15220 (3080464) 3080464..3080649 - 186 WP_001133046.1 hypothetical protein -
LZG51_RS15225 (3081223) 3081223..3081411 + 189 WP_000413705.1 cell division inhibition protein DicB -
LZG51_RS15230 (3081408) 3081408..3081599 + 192 WP_001098307.1 DUF1482 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 3068414..3092826 24412


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T266281 WP_001303876.1 NZ_CP114128:3077714-3078001 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT266281 WP_000536233.1 NZ_CP114128:3077523-3077714 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References