Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2481284..2481922 | Replicon | chromosome |
Accession | NZ_CP114128 | ||
Organism | Escherichia coli strain PE164 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | LZG51_RS12035 | Protein ID | WP_000813794.1 |
Coordinates | 2481284..2481460 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LZG51_RS12040 | Protein ID | WP_001270286.1 |
Coordinates | 2481506..2481922 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZG51_RS12015 (2476903) | 2476903..2478078 | - | 1176 | WP_053883748.1 | BenE family transporter YdcO | - |
LZG51_RS12020 (2478170) | 2478170..2478706 | + | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
LZG51_RS12025 (2478779) | 2478779..2480740 | + | 1962 | WP_207184267.1 | U32 family peptidase | - |
LZG51_RS12030 (2480832) | 2480832..2481062 | - | 231 | WP_000494244.1 | YncJ family protein | - |
LZG51_RS12035 (2481284) | 2481284..2481460 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
LZG51_RS12040 (2481506) | 2481506..2481922 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
LZG51_RS12045 (2482001) | 2482001..2483410 | + | 1410 | WP_000760625.1 | PLP-dependent aminotransferase family protein | - |
LZG51_RS12050 (2483652) | 2483652..2484797 | + | 1146 | WP_089637768.1 | ABC transporter substrate-binding protein | - |
LZG51_RS12055 (2484815) | 2484815..2485828 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
LZG51_RS12060 (2485829) | 2485829..2486770 | + | 942 | WP_053883752.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T266275 WP_000813794.1 NZ_CP114128:2481284-2481460 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT266275 WP_001270286.1 NZ_CP114128:2481506-2481922 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|