Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1873963..1874553 | Replicon | chromosome |
| Accession | NZ_CP114128 | ||
| Organism | Escherichia coli strain PE164 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A8S7CSP3 |
| Locus tag | LZG51_RS08900 | Protein ID | WP_053884197.1 |
| Coordinates | 1874221..1874553 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A8S7CTL7 |
| Locus tag | LZG51_RS08895 | Protein ID | WP_053884198.1 |
| Coordinates | 1873963..1874220 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZG51_RS08880 (1870975) | 1870975..1872579 | + | 1605 | WP_089553513.1 | LA2681 family HEPN domain-containing protein | - |
| LZG51_RS08885 (1872950) | 1872950..1873411 | + | 462 | WP_000201268.1 | hypothetical protein | - |
| LZG51_RS08890 (1873408) | 1873408..1873614 | + | 207 | WP_053884199.1 | helix-turn-helix transcriptional regulator | - |
| LZG51_RS08895 (1873963) | 1873963..1874220 | + | 258 | WP_053884198.1 | antitoxin | Antitoxin |
| LZG51_RS08900 (1874221) | 1874221..1874553 | + | 333 | WP_053884197.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LZG51_RS08905 (1875403) | 1875403..1876287 | + | 885 | WP_053884196.1 | integrase domain-containing protein | - |
| LZG51_RS08910 (1876561) | 1876561..1876872 | + | 312 | WP_064763322.1 | hypothetical protein | - |
| LZG51_RS08915 (1876859) | 1876859..1877215 | + | 357 | WP_053884194.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LZG51_RS08920 (1877222) | 1877222..1878760 | + | 1539 | WP_053884193.1 | IS66 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1851773..1927672 | 75899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11807.53 Da Isoelectric Point: 9.3417
>T266272 WP_053884197.1 NZ_CP114128:1874221-1874553 [Escherichia coli]
MDRGEIWLVSLDPTTGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGNFAREAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARSGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPTTGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGNFAREAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARSGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|