Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 307972..308772 | Replicon | chromosome |
Accession | NZ_CP114128 | ||
Organism | Escherichia coli strain PE164 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A0K4AFE4 |
Locus tag | LZG51_RS01385 | Protein ID | WP_001614005.1 |
Coordinates | 308245..308772 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A8S7FBC9 |
Locus tag | LZG51_RS01380 | Protein ID | WP_053883614.1 |
Coordinates | 307972..308238 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZG51_RS01360 (303630) | 303630..304298 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
LZG51_RS01365 (304291) | 304291..305349 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
LZG51_RS01370 (305594) | 305594..306448 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
LZG51_RS01375 (306719) | 306719..307822 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
LZG51_RS01380 (307972) | 307972..308238 | + | 267 | WP_053883614.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
LZG51_RS01385 (308245) | 308245..308772 | + | 528 | WP_001614005.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
LZG51_RS01390 (308769) | 308769..309152 | - | 384 | WP_000778770.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
LZG51_RS01395 (309576) | 309576..310685 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
LZG51_RS01400 (310733) | 310733..311659 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
LZG51_RS01405 (311656) | 311656..312933 | + | 1278 | WP_001626130.1 | branched chain amino acid ABC transporter permease LivM | - |
LZG51_RS01410 (312930) | 312930..313697 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.62 Da Isoelectric Point: 7.3502
>T266266 WP_001614005.1 NZ_CP114128:308245-308772 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|