Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 6637790..6638306 | Replicon | chromosome |
| Accession | NZ_CP114115 | ||
| Organism | Pseudomonas sp. GXZC | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZ428_RS31430 | Protein ID | WP_269132241.1 |
| Coordinates | 6637790..6638077 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | W2E0E6 |
| Locus tag | OZ428_RS31435 | Protein ID | WP_033897026.1 |
| Coordinates | 6638067..6638306 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZ428_RS31410 (OZ428_31410) | 6633384..6634331 | - | 948 | WP_269132240.1 | FecR family protein | - |
| OZ428_RS31415 (OZ428_31415) | 6634328..6634861 | - | 534 | WP_133075476.1 | RNA polymerase sigma factor | - |
| OZ428_RS31420 (OZ428_31420) | 6635068..6636066 | - | 999 | WP_269134240.1 | haloacid dehalogenase-like hydrolase | - |
| OZ428_RS31425 (OZ428_31425) | 6636367..6637758 | + | 1392 | WP_177110227.1 | L-cystine transporter | - |
| OZ428_RS31430 (OZ428_31430) | 6637790..6638077 | - | 288 | WP_269132241.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OZ428_RS31435 (OZ428_31435) | 6638067..6638306 | - | 240 | WP_033897026.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZ428_RS31440 (OZ428_31440) | 6638390..6638902 | - | 513 | WP_269132242.1 | dihydrofolate reductase | - |
| OZ428_RS31445 (OZ428_31445) | 6638972..6640342 | + | 1371 | WP_269132243.1 | DUF2868 domain-containing protein | - |
| OZ428_RS31450 (OZ428_31450) | 6640335..6641702 | + | 1368 | WP_269132245.1 | DUF3482 domain-containing protein | - |
| OZ428_RS31455 (OZ428_31455) | 6641708..6642241 | - | 534 | WP_133075481.1 | hypothetical protein | - |
| OZ428_RS31460 (OZ428_31460) | 6642333..6642887 | - | 555 | WP_133075482.1 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11223.02 Da Isoelectric Point: 9.8418
>T266264 WP_269132241.1 NZ_CP114115:c6638077-6637790 [Pseudomonas sp. GXZC]
MTYELDFDARALKEWHKLGDTVRQQFKKKLAAVLINPRIEASRLYGLPDCYKIKLRSSGYRLVYQVIDQEITVFVVAVDK
REREEVYRKAADRLS
MTYELDFDARALKEWHKLGDTVRQQFKKKLAAVLINPRIEASRLYGLPDCYKIKLRSSGYRLVYQVIDQEITVFVVAVDK
REREEVYRKAADRLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|