Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 5555349..5555989 | Replicon | chromosome |
Accession | NZ_CP114115 | ||
Organism | Pseudomonas sp. GXZC |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | OZ428_RS26190 | Protein ID | WP_269131788.1 |
Coordinates | 5555349..5555762 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | OZ428_RS26195 | Protein ID | WP_269131789.1 |
Coordinates | 5555759..5555989 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ428_RS26170 (OZ428_26170) | 5550444..5551133 | - | 690 | WP_010208305.1 | ABC transporter permease | - |
OZ428_RS26175 (OZ428_26175) | 5551225..5552010 | - | 786 | WP_033901307.1 | ABC transporter substrate-binding protein | - |
OZ428_RS26180 (OZ428_26180) | 5552572..5554527 | - | 1956 | WP_033902234.1 | acetate--CoA ligase | - |
OZ428_RS26185 (OZ428_26185) | 5554939..5555208 | + | 270 | WP_033902233.1 | DUF2790 domain-containing protein | - |
OZ428_RS26190 (OZ428_26190) | 5555349..5555762 | - | 414 | WP_269131788.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OZ428_RS26195 (OZ428_26195) | 5555759..5555989 | - | 231 | WP_269131789.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OZ428_RS26200 (OZ428_26200) | 5556470..5557720 | + | 1251 | WP_005790649.1 | ribonucleotide-diphosphate reductase subunit beta | - |
OZ428_RS26205 (OZ428_26205) | 5557813..5557945 | + | 133 | Protein_5170 | HNH endonuclease | - |
OZ428_RS26210 (OZ428_26210) | 5558018..5558659 | + | 642 | WP_038846731.1 | HAD-IB family hydrolase | - |
OZ428_RS26215 (OZ428_26215) | 5558783..5559007 | - | 225 | WP_269131790.1 | hypothetical protein | - |
OZ428_RS26220 (OZ428_26220) | 5559196..5560155 | - | 960 | WP_269131791.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15180.51 Da Isoelectric Point: 6.6986
>T266261 WP_269131788.1 NZ_CP114115:c5555762-5555349 [Pseudomonas sp. GXZC]
VTTYMLDTCICSFIMRERPECVLERLAAEVARSNRIVISAITYSEMRYGQIGKKASPKHKTLVDEFLRRLDEVLPWGLAA
VDATVEVKRSLAEAGLIIGQNDTAIAGHAIAAGCTLVTNNVREFSRVPGLSYEDWVH
VTTYMLDTCICSFIMRERPECVLERLAAEVARSNRIVISAITYSEMRYGQIGKKASPKHKTLVDEFLRRLDEVLPWGLAA
VDATVEVKRSLAEAGLIIGQNDTAIAGHAIAAGCTLVTNNVREFSRVPGLSYEDWVH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|