Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 4291010..4291479 Replicon chromosome
Accession NZ_CP114115
Organism Pseudomonas sp. GXZC

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OZ428_RS19915 Protein ID WP_269131027.1
Coordinates 4291010..4291285 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OZ428_RS19920 Protein ID WP_095015673.1
Coordinates 4291285..4291479 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZ428_RS19885 (OZ428_19885) 4286950..4287378 + 429 WP_269131023.1 hypothetical protein -
OZ428_RS19890 (OZ428_19890) 4287375..4287839 - 465 WP_061448885.1 nuclear transport factor 2 family protein -
OZ428_RS19895 (OZ428_19895) 4287859..4288818 - 960 WP_269131024.1 saccharopine dehydrogenase NADP-binding domain-containing protein -
OZ428_RS19900 (OZ428_19900) 4288815..4289216 - 402 WP_033896774.1 VOC family protein -
OZ428_RS19905 (OZ428_19905) 4289233..4289976 - 744 WP_269131025.1 SDR family oxidoreductase -
OZ428_RS19910 (OZ428_19910) 4290115..4291008 + 894 WP_269131026.1 AraC family transcriptional regulator -
OZ428_RS19915 (OZ428_19915) 4291010..4291285 - 276 WP_269131027.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OZ428_RS19920 (OZ428_19920) 4291285..4291479 - 195 WP_095015673.1 stability determinant Antitoxin
OZ428_RS19925 (OZ428_19925) 4291624..4293366 - 1743 WP_269131028.1 ABC transporter substrate-binding protein -
OZ428_RS19930 (OZ428_19930) 4293399..4293671 - 273 WP_016977309.1 DUF2160 domain-containing protein -
OZ428_RS19935 (OZ428_19935) 4293682..4294482 - 801 WP_003174634.1 carbohydrate ABC transporter permease -
OZ428_RS19940 (OZ428_19940) 4294493..4295359 - 867 WP_010209674.1 sugar ABC transporter permease -
OZ428_RS19945 (OZ428_19945) 4295356..4296453 - 1098 WP_269131029.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10358.99 Da        Isoelectric Point: 6.2166

>T266259 WP_269131027.1 NZ_CP114115:c4291285-4291010 [Pseudomonas sp. GXZC]
MLGVVWLDEAIADLIDIVTFIAAENPSAARRLKNRLESAPLPLTEHPYLYPNGRIPGTREVVVHPNYVLVYRVTAERIEI
INVLHARQEYP

Download         Length: 276 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7125.11 Da        Isoelectric Point: 5.6746

>AT266259 WP_095015673.1 NZ_CP114115:c4291479-4291285 [Pseudomonas sp. GXZC]
MGVPLSPIVSEFETEEQASRHDLWFRAKVEKSLANPGPGVPHDEVMARAEAIILEAERKQRAKA

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References