Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA(toxin) |
Location | 2919786..2920399 | Replicon | chromosome |
Accession | NZ_CP114115 | ||
Organism | Pseudomonas sp. GXZC |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A1YYQ4 |
Locus tag | OZ428_RS13950 | Protein ID | WP_038846635.1 |
Coordinates | 2920148..2920399 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OZ428_RS13945 | Protein ID | WP_269133768.1 |
Coordinates | 2919786..2920151 (-) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ428_RS13930 (OZ428_13930) | 2916620..2917192 | + | 573 | WP_269133765.1 | DUF2239 family protein | - |
OZ428_RS13935 (OZ428_13935) | 2917218..2918573 | + | 1356 | WP_269133766.1 | MATE family efflux transporter | - |
OZ428_RS13940 (OZ428_13940) | 2918613..2919785 | + | 1173 | WP_269133767.1 | MFS transporter | - |
OZ428_RS13945 (OZ428_13945) | 2919786..2920151 | - | 366 | WP_269133768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OZ428_RS13950 (OZ428_13950) | 2920148..2920399 | - | 252 | WP_038846635.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9518.11 Da Isoelectric Point: 10.0459
>T266257 WP_038846635.1 NZ_CP114115:c2920399-2920148 [Pseudomonas sp. GXZC]
VSKNEKLLAKLLNEHMAFTWPELVTLLRRLGYTQIEGAGSRVKFDIGDPSAMITLHKPHPGNELKHYIRRQIIEQLKSGE
LIQ
VSKNEKLLAKLLNEHMAFTWPELVTLLRRLGYTQIEGAGSRVKFDIGDPSAMITLHKPHPGNELKHYIRRQIIEQLKSGE
LIQ
Download Length: 252 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13178.97 Da Isoelectric Point: 6.7403
>AT266257 WP_269133768.1 NZ_CP114115:c2920151-2919786 [Pseudomonas sp. GXZC]
VNNQLKHKGYIGSIEASVEDNCLFGKILFIKALVSYEGKTVAELDAAFREAVDDYLATCQTLGHTPEKPCKGSFNVRVGH
DLHLAAALAATRKKVTLNDLTRQALNEFLQHHSDDACPAIG
VNNQLKHKGYIGSIEASVEDNCLFGKILFIKALVSYEGKTVAELDAAFREAVDDYLATCQTLGHTPEKPCKGSFNVRVGH
DLHLAAALAATRKKVTLNDLTRQALNEFLQHHSDDACPAIG
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|