Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2196352..2196956 | Replicon | chromosome |
| Accession | NZ_CP114115 | ||
| Organism | Pseudomonas sp. GXZC | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OZ428_RS10530 | Protein ID | WP_269133324.1 |
| Coordinates | 2196352..2196540 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OZ428_RS10535 | Protein ID | WP_269133325.1 |
| Coordinates | 2196552..2196956 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZ428_RS10505 (OZ428_10505) | 2192071..2192643 | + | 573 | WP_269133319.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
| OZ428_RS10510 (OZ428_10510) | 2192634..2193383 | + | 750 | WP_269133320.1 | phosphonate metabolism protein PhnP | - |
| OZ428_RS10515 (OZ428_10515) | 2193403..2194098 | - | 696 | WP_269133321.1 | helix-turn-helix transcriptional regulator | - |
| OZ428_RS10520 (OZ428_10520) | 2194173..2195294 | + | 1122 | WP_269133322.1 | cytochrome P450 | - |
| OZ428_RS10525 (OZ428_10525) | 2195280..2196161 | - | 882 | WP_269133323.1 | LysR family transcriptional regulator | - |
| OZ428_RS10530 (OZ428_10530) | 2196352..2196540 | + | 189 | WP_269133324.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OZ428_RS10535 (OZ428_10535) | 2196552..2196956 | + | 405 | WP_269133325.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OZ428_RS10540 (OZ428_10540) | 2197262..2198803 | + | 1542 | WP_269133326.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
| OZ428_RS10545 (OZ428_10545) | 2198813..2200009 | - | 1197 | WP_095015309.1 | MFS transporter | - |
| OZ428_RS10550 (OZ428_10550) | 2200181..2200795 | + | 615 | WP_269133327.1 | DUF5666 domain-containing protein | - |
| OZ428_RS10555 (OZ428_10555) | 2200925..2201929 | - | 1005 | WP_016979582.1 | sulfate ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7139.35 Da Isoelectric Point: 10.5621
>T266255 WP_269133324.1 NZ_CP114115:2196352-2196540 [Pseudomonas sp. GXZC]
VQSRLLIKELQEAGWVLDRVTGSHHIFTHCYSPYTLPVPHPKKDLPLGTVRSIRKRAGLFQF
VQSRLLIKELQEAGWVLDRVTGSHHIFTHCYSPYTLPVPHPKKDLPLGTVRSIRKRAGLFQF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14773.74 Da Isoelectric Point: 4.4999
>AT266255 WP_269133325.1 NZ_CP114115:2196552-2196956 [Pseudomonas sp. GXZC]
MQYPICIEWGDDFTATGIQIPDIPGAVTAGDSFEEAYNAAVEIAHIMLQEIAAEGGPIPMPTSVANHHAHEDYADMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRS
MQYPICIEWGDDFTATGIQIPDIPGAVTAGDSFEEAYNAAVEIAHIMLQEIAAEGGPIPMPTSVANHHAHEDYADMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRS
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|