Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1858651..1859266 Replicon chromosome
Accession NZ_CP114115
Organism Pseudomonas sp. GXZC

Toxin (Protein)


Gene name hicA Uniprot ID W2D6J2
Locus tag OZ428_RS08830 Protein ID WP_012722731.1
Coordinates 1859084..1859266 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID W2D6D2
Locus tag OZ428_RS08825 Protein ID WP_033902677.1
Coordinates 1858651..1859061 (-) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZ428_RS08785 (OZ428_08785) 1854187..1855104 + 918 WP_269133138.1 LysR family transcriptional regulator -
OZ428_RS08790 (OZ428_08790) 1855112..1855396 - 285 WP_269133139.1 type II toxin-antitoxin system RelE/ParE family toxin -
OZ428_RS08795 (OZ428_08795) 1855386..1855625 - 240 WP_133074346.1 ribbon-helix-helix protein, CopG family -
OZ428_RS08800 (OZ428_08800) 1855730..1856140 + 411 WP_133074345.1 fosfomycin resistance glutathione transferase -
OZ428_RS08805 (OZ428_08805) 1856195..1856836 + 642 WP_133074344.1 LysE family translocator -
OZ428_RS08810 (OZ428_08810) 1856956..1857483 + 528 WP_133074343.1 DUF4142 domain-containing protein -
OZ428_RS08815 (OZ428_08815) 1857539..1857964 - 426 WP_038842343.1 low affinity iron permease family protein -
OZ428_RS08820 (OZ428_08820) 1858047..1858547 - 501 WP_033902678.1 methylated-DNA--[protein]-cysteine S-methyltransferase -
OZ428_RS08825 (OZ428_08825) 1858651..1859061 - 411 WP_033902677.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OZ428_RS08830 (OZ428_08830) 1859084..1859266 - 183 WP_012722731.1 type II toxin-antitoxin system HicA family toxin Toxin
OZ428_RS08835 (OZ428_08835) 1859436..1860329 - 894 WP_269133140.1 LysR family transcriptional regulator -
OZ428_RS08840 (OZ428_08840) 1860425..1861588 + 1164 WP_269133141.1 MFS transporter -
OZ428_RS08845 (OZ428_08845) 1861585..1862751 + 1167 WP_269133142.1 MFS transporter -
OZ428_RS08850 (OZ428_08850) 1863075..1863314 + 240 WP_269133143.1 DUF6124 family protein -
OZ428_RS08855 (OZ428_08855) 1863393..1863698 - 306 WP_269133144.1 DUF6482 family protein -
OZ428_RS08860 (OZ428_08860) 1863722..1864246 - 525 WP_269133145.1 DUF3833 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1852298..1859266 6968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6775.96 Da        Isoelectric Point: 10.7532

>T266254 WP_012722731.1 NZ_CP114115:c1859266-1859084 [Pseudomonas sp. GXZC]
VDSRYLIGHIVADGWYLARIRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLS

Download         Length: 183 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14721.60 Da        Isoelectric Point: 4.3123

>AT266254 WP_033902677.1 NZ_CP114115:c1859061-1858651 [Pseudomonas sp. GXZC]
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQEG

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W2D6J2

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y8G830

References