Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RHH
Location 1855112..1855625 Replicon chromosome
Accession NZ_CP114115
Organism Pseudomonas sp. GXZC

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OZ428_RS08790 Protein ID WP_269133139.1
Coordinates 1855112..1855396 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OZ428_RS08795 Protein ID WP_133074346.1
Coordinates 1855386..1855625 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZ428_RS08770 (OZ428_08770) 1851297..1852238 + 942 WP_269133136.1 hydroxymethylglutaryl-CoA lyase -
OZ428_RS08775 (OZ428_08775) 1852298..1853629 + 1332 WP_269133137.1 MFS transporter -
OZ428_RS08780 (OZ428_08780) 1853630..1854118 - 489 WP_133074349.1 DMT family transporter -
OZ428_RS08785 (OZ428_08785) 1854187..1855104 + 918 WP_269133138.1 LysR family transcriptional regulator -
OZ428_RS08790 (OZ428_08790) 1855112..1855396 - 285 WP_269133139.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OZ428_RS08795 (OZ428_08795) 1855386..1855625 - 240 WP_133074346.1 ribbon-helix-helix protein, CopG family Antitoxin
OZ428_RS08800 (OZ428_08800) 1855730..1856140 + 411 WP_133074345.1 fosfomycin resistance glutathione transferase -
OZ428_RS08805 (OZ428_08805) 1856195..1856836 + 642 WP_133074344.1 LysE family translocator -
OZ428_RS08810 (OZ428_08810) 1856956..1857483 + 528 WP_133074343.1 DUF4142 domain-containing protein -
OZ428_RS08815 (OZ428_08815) 1857539..1857964 - 426 WP_038842343.1 low affinity iron permease family protein -
OZ428_RS08820 (OZ428_08820) 1858047..1858547 - 501 WP_033902678.1 methylated-DNA--[protein]-cysteine S-methyltransferase -
OZ428_RS08825 (OZ428_08825) 1858651..1859061 - 411 WP_033902677.1 type II toxin-antitoxin system HicB family antitoxin -
OZ428_RS08830 (OZ428_08830) 1859084..1859266 - 183 WP_012722731.1 type II toxin-antitoxin system HicA family toxin -
OZ428_RS08835 (OZ428_08835) 1859436..1860329 - 894 WP_269133140.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1852298..1859266 6968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-41)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11027.70 Da        Isoelectric Point: 9.6936

>T266253 WP_269133139.1 NZ_CP114115:c1855396-1855112 [Pseudomonas sp. GXZC]
MQVEWLRTALRNLDDEAAYIAEENPKAAHEFVQEILTGLQQIAEFPAMGKEGRVPGTREWVVPRWPYIVPYRIRGGRLQV
MRIFHTRRQPPASW

Download         Length: 285 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8583.69 Da        Isoelectric Point: 4.4367

>AT266253 WP_133074346.1 NZ_CP114115:c1855625-1855386 [Pseudomonas sp. GXZC]
MSVMSLRIPEDIADTLASLAKATGRSKSFLAVDALREYLTREAWQIEEIQKALKEADAGDFATAAEVEAVADKWRANAG

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References