Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RHH |
| Location | 1855112..1855625 | Replicon | chromosome |
| Accession | NZ_CP114115 | ||
| Organism | Pseudomonas sp. GXZC | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZ428_RS08790 | Protein ID | WP_269133139.1 |
| Coordinates | 1855112..1855396 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OZ428_RS08795 | Protein ID | WP_133074346.1 |
| Coordinates | 1855386..1855625 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZ428_RS08770 (OZ428_08770) | 1851297..1852238 | + | 942 | WP_269133136.1 | hydroxymethylglutaryl-CoA lyase | - |
| OZ428_RS08775 (OZ428_08775) | 1852298..1853629 | + | 1332 | WP_269133137.1 | MFS transporter | - |
| OZ428_RS08780 (OZ428_08780) | 1853630..1854118 | - | 489 | WP_133074349.1 | DMT family transporter | - |
| OZ428_RS08785 (OZ428_08785) | 1854187..1855104 | + | 918 | WP_269133138.1 | LysR family transcriptional regulator | - |
| OZ428_RS08790 (OZ428_08790) | 1855112..1855396 | - | 285 | WP_269133139.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OZ428_RS08795 (OZ428_08795) | 1855386..1855625 | - | 240 | WP_133074346.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| OZ428_RS08800 (OZ428_08800) | 1855730..1856140 | + | 411 | WP_133074345.1 | fosfomycin resistance glutathione transferase | - |
| OZ428_RS08805 (OZ428_08805) | 1856195..1856836 | + | 642 | WP_133074344.1 | LysE family translocator | - |
| OZ428_RS08810 (OZ428_08810) | 1856956..1857483 | + | 528 | WP_133074343.1 | DUF4142 domain-containing protein | - |
| OZ428_RS08815 (OZ428_08815) | 1857539..1857964 | - | 426 | WP_038842343.1 | low affinity iron permease family protein | - |
| OZ428_RS08820 (OZ428_08820) | 1858047..1858547 | - | 501 | WP_033902678.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| OZ428_RS08825 (OZ428_08825) | 1858651..1859061 | - | 411 | WP_033902677.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| OZ428_RS08830 (OZ428_08830) | 1859084..1859266 | - | 183 | WP_012722731.1 | type II toxin-antitoxin system HicA family toxin | - |
| OZ428_RS08835 (OZ428_08835) | 1859436..1860329 | - | 894 | WP_269133140.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1852298..1859266 | 6968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11027.70 Da Isoelectric Point: 9.6936
>T266253 WP_269133139.1 NZ_CP114115:c1855396-1855112 [Pseudomonas sp. GXZC]
MQVEWLRTALRNLDDEAAYIAEENPKAAHEFVQEILTGLQQIAEFPAMGKEGRVPGTREWVVPRWPYIVPYRIRGGRLQV
MRIFHTRRQPPASW
MQVEWLRTALRNLDDEAAYIAEENPKAAHEFVQEILTGLQQIAEFPAMGKEGRVPGTREWVVPRWPYIVPYRIRGGRLQV
MRIFHTRRQPPASW
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|