Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 789007..789599 | Replicon | chromosome |
Accession | NZ_CP114115 | ||
Organism | Pseudomonas sp. GXZC |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OZ428_RS03655 | Protein ID | WP_269132730.1 |
Coordinates | 789291..789599 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OZ428_RS03650 | Protein ID | WP_233893633.1 |
Coordinates | 789007..789294 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ428_RS03630 (OZ428_03630) | 785429..787489 | - | 2061 | WP_269132727.1 | TonB-dependent copper receptor | - |
OZ428_RS03635 (OZ428_03635) | 787583..787972 | - | 390 | WP_016976979.1 | DUF2946 domain-containing protein | - |
OZ428_RS03640 (OZ428_03640) | 787984..788466 | - | 483 | WP_269132728.1 | copper chaperone PCu(A)C | - |
OZ428_RS03645 (OZ428_03645) | 788514..788909 | - | 396 | WP_269132729.1 | DUF2946 domain-containing protein | - |
OZ428_RS03650 (OZ428_03650) | 789007..789294 | - | 288 | WP_233893633.1 | putative addiction module antidote protein | Antitoxin |
OZ428_RS03655 (OZ428_03655) | 789291..789599 | - | 309 | WP_269132730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ428_RS03660 (OZ428_03660) | 789949..790668 | - | 720 | WP_269132731.1 | cobalt-precorrin-6A reductase | - |
OZ428_RS03665 (OZ428_03665) | 790665..791870 | - | 1206 | WP_269132732.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
OZ428_RS03670 (OZ428_03670) | 791909..793255 | + | 1347 | WP_269132733.1 | precorrin-3B synthase | - |
OZ428_RS03675 (OZ428_03675) | 793248..793874 | + | 627 | WP_016976987.1 | precorrin-8X methylmutase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11702.15 Da Isoelectric Point: 9.5427
>T266251 WP_269132730.1 NZ_CP114115:c789599-789291 [Pseudomonas sp. GXZC]
MIRFKRSDEFQEWLDSSRSRPARGRVLTRLDNATRGNFGDCAPVGNGVSEMRIHYGPGYRVYFTRVDEVVYLLLIGGDKS
TQKRDIQRAKEIADEFGIRSDS
MIRFKRSDEFQEWLDSSRSRPARGRVLTRLDNATRGNFGDCAPVGNGVSEMRIHYGPGYRVYFTRVDEVVYLLLIGGDKS
TQKRDIQRAKEIADEFGIRSDS
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|