Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/- |
Location | 361065..361557 | Replicon | chromosome |
Accession | NZ_CP114115 | ||
Organism | Pseudomonas sp. GXZC |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OZ428_RS01760 | Protein ID | WP_269134144.1 |
Coordinates | 361249..361557 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OZ428_RS01755 | Protein ID | WP_269132562.1 |
Coordinates | 361065..361259 (+) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ428_RS01735 (OZ428_01735) | 356703..357476 | - | 774 | WP_010213906.1 | ABC transporter ATP-binding protein | - |
OZ428_RS01740 (OZ428_01740) | 358031..359422 | + | 1392 | WP_033896896.1 | GABA permease | - |
OZ428_RS01745 (OZ428_01745) | 359477..359890 | - | 414 | WP_269132561.1 | hypothetical protein | - |
OZ428_RS01750 (OZ428_01750) | 359895..360881 | - | 987 | WP_133076498.1 | alpha/beta fold hydrolase | - |
OZ428_RS01755 (OZ428_01755) | 361065..361259 | + | 195 | WP_269132562.1 | hypothetical protein | Antitoxin |
OZ428_RS01760 (OZ428_01760) | 361249..361557 | + | 309 | WP_269134144.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ428_RS01765 (OZ428_01765) | 361599..362564 | + | 966 | WP_269132563.1 | arsenic resistance protein | - |
OZ428_RS01770 (OZ428_01770) | 362652..364244 | + | 1593 | WP_269132564.1 | hypothetical protein | - |
OZ428_RS01775 (OZ428_01775) | 364333..364608 | + | 276 | WP_028615360.1 | hypothetical protein | - |
OZ428_RS01780 (OZ428_01780) | 364961..365206 | - | 246 | WP_000108283.1 | DUF2274 domain-containing protein | - |
OZ428_RS01785 (OZ428_01785) | 365203..366483 | - | 1281 | WP_058654952.1 | TrbI/VirB10 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / sul1 / tet(G) / floR | - | 340126..438734 | 98608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11713.61 Da Isoelectric Point: 6.9876
>T266250 WP_269134144.1 NZ_CP114115:361249-361557 [Pseudomonas sp. GXZC]
MLVKWRPEAILVLTEIIDFIEQYNPVAAASLHRNIVAATEHLSSMPYGFKQGRLSGTREMVVHPNYLVVYRVMEQVDILT
VLHTRQEYPSDAIVPLHSTLRQ
MLVKWRPEAILVLTEIIDFIEQYNPVAAASLHRNIVAATEHLSSMPYGFKQGRLSGTREMVVHPNYLVVYRVMEQVDILT
VLHTRQEYPSDAIVPLHSTLRQ
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|