Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1377165..1378081 | Replicon | chromosome |
Accession | NZ_CP114066 | ||
Organism | Bacillus halotolerans strain B13 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | O0R52_RS06910 | Protein ID | WP_044156223.1 |
Coordinates | 1377335..1378081 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | O0R52_RS06905 | Protein ID | WP_024121090.1 |
Coordinates | 1377165..1377335 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0R52_RS06870 (O0R52_06870) | 1374029..1374358 | + | 330 | WP_044156231.1 | XkdW family protein | - |
O0R52_RS06875 (O0R52_06875) | 1374355..1374519 | + | 165 | WP_044156230.1 | XkdX family protein | - |
O0R52_RS06880 (O0R52_06880) | 1374563..1375402 | + | 840 | WP_044156229.1 | hypothetical protein | - |
O0R52_RS06885 (O0R52_06885) | 1375458..1375727 | + | 270 | WP_044156228.1 | hemolysin XhlA family protein | - |
O0R52_RS06890 (O0R52_06890) | 1375739..1376002 | + | 264 | WP_044156226.1 | phage holin | - |
O0R52_RS06895 (O0R52_06895) | 1376015..1376908 | + | 894 | WP_217827104.1 | N-acetylmuramoyl-L-alanine amidase | - |
O0R52_RS06900 (O0R52_06900) | 1376944..1377081 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
O0R52_RS06905 (O0R52_06905) | 1377165..1377335 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
O0R52_RS06910 (O0R52_06910) | 1377335..1378081 | - | 747 | WP_044156223.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
O0R52_RS06915 (O0R52_06915) | 1378190..1379191 | - | 1002 | WP_044156221.1 | inorganic phosphate transporter | - |
O0R52_RS06920 (O0R52_06920) | 1379204..1379821 | - | 618 | WP_044156219.1 | DUF47 domain-containing protein | - |
O0R52_RS06925 (O0R52_06925) | 1380100..1381416 | - | 1317 | WP_044156218.1 | serine/threonine exchanger | - |
O0R52_RS06930 (O0R52_06930) | 1381811..1382761 | + | 951 | WP_059292934.1 | ring-cleaving dioxygenase | - |
O0R52_RS06935 (O0R52_06935) | 1382927..1383007 | + | 81 | Protein_1302 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29102.52 Da Isoelectric Point: 4.4373
>T266249 WP_044156223.1 NZ_CP114066:c1378081-1377335 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CYYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CYYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|