Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4693910..4694472 | Replicon | chromosome |
| Accession | NZ_CP114065 | ||
| Organism | Kribbella sp. CA-293567 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OX958_RS21490 | Protein ID | WP_270130895.1 |
| Coordinates | 4694161..4694472 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | OX958_RS21485 | Protein ID | WP_270130893.1 |
| Coordinates | 4693910..4694161 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OX958_RS21460 (OX958_21495) | 4689912..4691225 | - | 1314 | WP_270130887.1 | histidinol dehydrogenase | - |
| OX958_RS21465 (OX958_21500) | 4691349..4692017 | + | 669 | WP_270130888.1 | LON peptidase substrate-binding domain-containing protein | - |
| OX958_RS21470 (OX958_21505) | 4692019..4692402 | + | 384 | WP_270130889.1 | hypothetical protein | - |
| OX958_RS21475 (OX958_21510) | 4692454..4693290 | + | 837 | WP_270130890.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| OX958_RS21480 (OX958_21515) | 4693287..4693877 | + | 591 | WP_270130891.1 | dihydrofolate reductase family protein | - |
| OX958_RS21485 (OX958_21520) | 4693910..4694161 | + | 252 | WP_270130893.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| OX958_RS21490 (OX958_21525) | 4694161..4694472 | + | 312 | WP_270130895.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OX958_RS21495 (OX958_21530) | 4694478..4696328 | - | 1851 | WP_270130897.1 | dihydroxy-acid dehydratase | - |
| OX958_RS21500 (OX958_21535) | 4696467..4697309 | + | 843 | WP_270130899.1 | helix-turn-helix domain-containing protein | - |
| OX958_RS21505 (OX958_21540) | 4697306..4697743 | + | 438 | WP_270130901.1 | VOC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11255.22 Da Isoelectric Point: 7.1661
>T266247 WP_270130895.1 NZ_CP114065:4694161-4694472 [Kribbella sp. CA-293567]
MRPLHIARLDKPRPVVVLTRELIRPRLTNVTVAPITSTIRGLSTEVLVGVRNGLDHPSAISCDNVQTIPKLQLGRLIGYL
LPDQEAALAEAITLAFDLEADLL
MRPLHIARLDKPRPVVVLTRELIRPRLTNVTVAPITSTIRGLSTEVLVGVRNGLDHPSAISCDNVQTIPKLQLGRLIGYL
LPDQEAALAEAITLAFDLEADLL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|