Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4836317..4837031 | Replicon | chromosome |
Accession | NZ_CP114062 | ||
Organism | Rouxiella badensis strain DAR84756 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1X0WDA6 |
Locus tag | O1V65_RS22345 | Protein ID | WP_038328038.1 |
Coordinates | 4836564..4837031 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A1X0WD57 |
Locus tag | O1V65_RS22340 | Protein ID | WP_017492114.1 |
Coordinates | 4836317..4836583 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1V65_RS22325 (O1V65_22320) | 4831643..4832290 | + | 648 | WP_269130046.1 | hemolysin III family protein | - |
O1V65_RS22330 (O1V65_22325) | 4832506..4834935 | + | 2430 | WP_269130047.1 | M60 family metallopeptidase | - |
O1V65_RS22335 (O1V65_22330) | 4835047..4836039 | - | 993 | WP_017491354.1 | tRNA-modifying protein YgfZ | - |
O1V65_RS22340 (O1V65_22335) | 4836317..4836583 | + | 267 | WP_017492114.1 | FAD assembly factor SdhE | Antitoxin |
O1V65_RS22345 (O1V65_22340) | 4836564..4837031 | + | 468 | WP_038328038.1 | protein YgfX | Toxin |
O1V65_RS22350 (O1V65_22345) | 4837053..4837571 | - | 519 | WP_017492112.1 | flavodoxin FldB | - |
O1V65_RS22355 (O1V65_22350) | 4837728..4838609 | + | 882 | WP_038328043.1 | site-specific tyrosine recombinase XerD | - |
O1V65_RS22360 (O1V65_22355) | 4838636..4839343 | + | 708 | WP_017492110.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
O1V65_RS22365 (O1V65_22360) | 4839406..4841139 | + | 1734 | WP_026110554.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 18280.52 Da Isoelectric Point: 11.7962
>T266246 WP_038328038.1 NZ_CP114062:4836564-4837031 [Rouxiella badensis]
VALWQCDLRVSWRSQLFSLAVHGILILLILLAPWPPDDWMIWLILLIIVVSQSIRSQRRISARQGEISLLAQDRLLWRKQ
EWKIKQPVWMIDSGILLSLRRERTGHGWRQALRGKKHKLWLASDSMSQEEWRHLRQILLTGKRDAAPANNNHHPL
VALWQCDLRVSWRSQLFSLAVHGILILLILLAPWPPDDWMIWLILLIIVVSQSIRSQRRISARQGEISLLAQDRLLWRKQ
EWKIKQPVWMIDSGILLSLRRERTGHGWRQALRGKKHKLWLASDSMSQEEWRHLRQILLTGKRDAAPANNNHHPL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X0WDA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X0WD57 |