Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3045804..3046420 | Replicon | chromosome |
| Accession | NZ_CP114062 | ||
| Organism | Rouxiella badensis strain DAR84756 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1X0WJL4 |
| Locus tag | O1V65_RS14120 | Protein ID | WP_026110585.1 |
| Coordinates | 3046217..3046420 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1X0WJ85 |
| Locus tag | O1V65_RS14115 | Protein ID | WP_017492280.1 |
| Coordinates | 3045804..3046172 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1V65_RS14085 (O1V65_14080) | 3041766..3042020 | + | 255 | WP_009639086.1 | type B 50S ribosomal protein L31 | - |
| O1V65_RS14090 (O1V65_14085) | 3042041..3042181 | + | 141 | WP_009639085.1 | type B 50S ribosomal protein L36 | - |
| O1V65_RS14095 (O1V65_14090) | 3042314..3043192 | - | 879 | WP_017492284.1 | metal ABC transporter substrate-binding protein | - |
| O1V65_RS14100 (O1V65_14095) | 3043229..3044086 | - | 858 | WP_017492283.1 | metal ABC transporter permease | - |
| O1V65_RS14105 (O1V65_14100) | 3044083..3044820 | - | 738 | WP_017492282.1 | ABC transporter ATP-binding protein | - |
| O1V65_RS14110 (O1V65_14105) | 3045250..3045603 | + | 354 | WP_017492281.1 | hypothetical protein | - |
| O1V65_RS14115 (O1V65_14110) | 3045804..3046172 | + | 369 | WP_017492280.1 | Hha toxicity modulator TomB | Antitoxin |
| O1V65_RS14120 (O1V65_14115) | 3046217..3046420 | + | 204 | WP_026110585.1 | HHA domain-containing protein | Toxin |
| O1V65_RS14125 (O1V65_14120) | 3046599..3047525 | - | 927 | WP_017492278.1 | LysR family transcriptional regulator | - |
| O1V65_RS14130 (O1V65_14125) | 3047669..3049456 | + | 1788 | WP_165429737.1 | adenine deaminase C-terminal domain-containing protein | - |
| O1V65_RS14135 (O1V65_14130) | 3049521..3050870 | + | 1350 | WP_269129821.1 | NCS2 family permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8115.43 Da Isoelectric Point: 7.9892
>T266245 WP_026110585.1 NZ_CP114062:3046217-3046420 [Rouxiella badensis]
MNKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELELFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MNKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELELFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14280.97 Da Isoelectric Point: 4.5844
>AT266245 WP_017492280.1 NZ_CP114062:3045804-3046172 [Rouxiella badensis]
MDEYSPKRHDIAQLRFLNESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDETNLSDLVEEYL
DDTYTLFSNYGINDSDLRQWQKTKKRLFRMFSGDYVCTLMKT
MDEYSPKRHDIAQLRFLNESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDETNLSDLVEEYL
DDTYTLFSNYGINDSDLRQWQKTKKRLFRMFSGDYVCTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X0WJL4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X0WJ85 |