Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2966563..2967258 | Replicon | chromosome |
Accession | NZ_CP114062 | ||
Organism | Rouxiella badensis strain DAR84756 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | O1V65_RS13755 | Protein ID | WP_269129793.1 |
Coordinates | 2966563..2966883 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | O1V65_RS13760 | Protein ID | WP_269129794.1 |
Coordinates | 2966935..2967258 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1V65_RS13730 (O1V65_13725) | 2962364..2963209 | + | 846 | WP_017492635.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
O1V65_RS13735 (O1V65_13730) | 2963206..2964006 | - | 801 | WP_017492636.1 | SDR family oxidoreductase | - |
O1V65_RS13740 (O1V65_13735) | 2964118..2964381 | - | 264 | WP_017492637.1 | DUF2798 domain-containing protein | - |
O1V65_RS13745 (O1V65_13740) | 2964510..2965409 | + | 900 | WP_269129791.1 | LysR family transcriptional regulator | - |
O1V65_RS13750 (O1V65_13745) | 2965616..2966449 | - | 834 | WP_269129792.1 | DUF4942 domain-containing protein | - |
O1V65_RS13755 (O1V65_13750) | 2966563..2966883 | - | 321 | WP_269129793.1 | TA system toxin CbtA family protein | Toxin |
O1V65_RS13760 (O1V65_13755) | 2966935..2967258 | - | 324 | WP_269129794.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
O1V65_RS13765 (O1V65_13760) | 2967271..2967741 | - | 471 | WP_269129795.1 | DNA repair protein RadC | - |
O1V65_RS13770 (O1V65_13765) | 2967807..2968628 | - | 822 | WP_269129796.1 | DUF932 domain-containing protein | - |
O1V65_RS13775 (O1V65_13770) | 2968844..2969155 | - | 312 | WP_269129797.1 | hypothetical protein | - |
O1V65_RS13780 (O1V65_13775) | 2969168..2969452 | - | 285 | WP_269129798.1 | hypothetical protein | - |
O1V65_RS13785 (O1V65_13780) | 2969518..2970024 | - | 507 | WP_269129799.1 | hypothetical protein | - |
O1V65_RS13790 (O1V65_13785) | 2970021..2970749 | - | 729 | WP_269129800.1 | WYL domain-containing protein | - |
O1V65_RS13795 (O1V65_13790) | 2970969..2971853 | - | 885 | WP_269129801.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12060.77 Da Isoelectric Point: 6.8779
>T266244 WP_269129793.1 NZ_CP114062:c2966883-2966563 [Rouxiella badensis]
MQISTVPATVPVSSRLSPVQTWQQLLTYLLDHHYGLVLNDTPFHDEAVIQEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQNQAPFLTATNILRARRATGLMNK
MQISTVPATVPVSSRLSPVQTWQQLLTYLLDHHYGLVLNDTPFHDEAVIQEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQNQAPFLTATNILRARRATGLMNK
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|