Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1257797..1258456 | Replicon | chromosome |
| Accession | NZ_CP114062 | ||
| Organism | Rouxiella badensis strain DAR84756 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | O1V65_RS06080 | Protein ID | WP_017491644.1 |
| Coordinates | 1258268..1258456 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O1V65_RS06075 | Protein ID | WP_017491645.1 |
| Coordinates | 1257797..1258204 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1V65_RS06035 (O1V65_06030) | 1252918..1253520 | + | 603 | WP_269130286.1 | recombination protein NinG | - |
| O1V65_RS06040 (O1V65_06035) | 1253517..1253759 | + | 243 | WP_017491647.1 | hypothetical protein | - |
| O1V65_RS06045 (O1V65_06040) | 1253845..1254612 | + | 768 | WP_269130287.1 | antitermination protein | - |
| O1V65_RS06050 (O1V65_06045) | 1254786..1255226 | - | 441 | WP_269130288.1 | Arc family DNA-binding protein | - |
| O1V65_RS06055 (O1V65_06050) | 1255347..1255514 | + | 168 | WP_269130289.1 | Arc family DNA binding domain-containing protein | - |
| O1V65_RS06060 (O1V65_06055) | 1255587..1256474 | + | 888 | WP_269130290.1 | phage antirepressor N-terminal domain-containing protein | - |
| O1V65_RS06065 (O1V65_06060) | 1256554..1257345 | + | 792 | WP_269130291.1 | ORF6N domain-containing protein | - |
| O1V65_RS06070 (O1V65_06065) | 1257342..1257578 | + | 237 | WP_269130292.1 | hypothetical protein | - |
| O1V65_RS06075 (O1V65_06070) | 1257797..1258204 | - | 408 | WP_017491645.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| O1V65_RS06080 (O1V65_06075) | 1258268..1258456 | - | 189 | WP_017491644.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| O1V65_RS06085 (O1V65_06080) | 1258640..1259281 | + | 642 | WP_017491643.1 | hypothetical protein | - |
| O1V65_RS06090 (O1V65_06085) | 1259262..1260215 | + | 954 | WP_269130293.1 | glycosyltransferase family 1 protein | - |
| O1V65_RS06095 (O1V65_06090) | 1260352..1260666 | + | 315 | WP_017491641.1 | hypothetical protein | - |
| O1V65_RS06100 (O1V65_06095) | 1260666..1261160 | + | 495 | WP_269130294.1 | lysozyme | - |
| O1V65_RS06105 (O1V65_06100) | 1261264..1261683 | + | 420 | WP_269130296.1 | hypothetical protein | - |
| O1V65_RS06110 (O1V65_06105) | 1261791..1261994 | + | 204 | WP_269130297.1 | hypothetical protein | - |
| O1V65_RS06115 (O1V65_06110) | 1262075..1262422 | + | 348 | WP_269130298.1 | hypothetical protein | - |
| O1V65_RS06120 (O1V65_06115) | 1262522..1262755 | + | 234 | WP_269130299.1 | hypothetical protein | - |
| O1V65_RS06125 (O1V65_06120) | 1262806..1263042 | + | 237 | WP_269130300.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1235062..1285125 | 50063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7135.33 Da Isoelectric Point: 10.9194
>T266239 WP_017491644.1 NZ_CP114062:c1258456-1258268 [Rouxiella badensis]
MQSRELIKLLEADGWKEVGRSGSHRTFSKEGVREIITIPHPRKDTSKGILRQVQKYTGMKLL
MQSRELIKLLEADGWKEVGRSGSHRTFSKEGVREIITIPHPRKDTSKGILRQVQKYTGMKLL
Download Length: 189 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14882.74 Da Isoelectric Point: 4.3708
>AT266239 WP_017491645.1 NZ_CP114062:c1258204-1257797 [Rouxiella badensis]
MIYPIFIFKSESGFDGYFPDVPGCFFSGDTLEDAVKDSEAAFGAHCDVLTERGDHVPAPADVSAYLGDERLIEDGGFLGF
VEIDPTKYESKAVKFNLTMPSNLIAAIDRFIEKNGQYKNRSAFLAELARKEIARG
MIYPIFIFKSESGFDGYFPDVPGCFFSGDTLEDAVKDSEAAFGAHCDVLTERGDHVPAPADVSAYLGDERLIEDGGFLGF
VEIDPTKYESKAVKFNLTMPSNLIAAIDRFIEKNGQYKNRSAFLAELARKEIARG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|