Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1257797..1258456 Replicon chromosome
Accession NZ_CP114062
Organism Rouxiella badensis strain DAR84756

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag O1V65_RS06080 Protein ID WP_017491644.1
Coordinates 1258268..1258456 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag O1V65_RS06075 Protein ID WP_017491645.1
Coordinates 1257797..1258204 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1V65_RS06035 (O1V65_06030) 1252918..1253520 + 603 WP_269130286.1 recombination protein NinG -
O1V65_RS06040 (O1V65_06035) 1253517..1253759 + 243 WP_017491647.1 hypothetical protein -
O1V65_RS06045 (O1V65_06040) 1253845..1254612 + 768 WP_269130287.1 antitermination protein -
O1V65_RS06050 (O1V65_06045) 1254786..1255226 - 441 WP_269130288.1 Arc family DNA-binding protein -
O1V65_RS06055 (O1V65_06050) 1255347..1255514 + 168 WP_269130289.1 Arc family DNA binding domain-containing protein -
O1V65_RS06060 (O1V65_06055) 1255587..1256474 + 888 WP_269130290.1 phage antirepressor N-terminal domain-containing protein -
O1V65_RS06065 (O1V65_06060) 1256554..1257345 + 792 WP_269130291.1 ORF6N domain-containing protein -
O1V65_RS06070 (O1V65_06065) 1257342..1257578 + 237 WP_269130292.1 hypothetical protein -
O1V65_RS06075 (O1V65_06070) 1257797..1258204 - 408 WP_017491645.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
O1V65_RS06080 (O1V65_06075) 1258268..1258456 - 189 WP_017491644.1 type II toxin-antitoxin system HicA family toxin Toxin
O1V65_RS06085 (O1V65_06080) 1258640..1259281 + 642 WP_017491643.1 hypothetical protein -
O1V65_RS06090 (O1V65_06085) 1259262..1260215 + 954 WP_269130293.1 glycosyltransferase family 1 protein -
O1V65_RS06095 (O1V65_06090) 1260352..1260666 + 315 WP_017491641.1 hypothetical protein -
O1V65_RS06100 (O1V65_06095) 1260666..1261160 + 495 WP_269130294.1 lysozyme -
O1V65_RS06105 (O1V65_06100) 1261264..1261683 + 420 WP_269130296.1 hypothetical protein -
O1V65_RS06110 (O1V65_06105) 1261791..1261994 + 204 WP_269130297.1 hypothetical protein -
O1V65_RS06115 (O1V65_06110) 1262075..1262422 + 348 WP_269130298.1 hypothetical protein -
O1V65_RS06120 (O1V65_06115) 1262522..1262755 + 234 WP_269130299.1 hypothetical protein -
O1V65_RS06125 (O1V65_06120) 1262806..1263042 + 237 WP_269130300.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1235062..1285125 50063


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7135.33 Da        Isoelectric Point: 10.9194

>T266239 WP_017491644.1 NZ_CP114062:c1258456-1258268 [Rouxiella badensis]
MQSRELIKLLEADGWKEVGRSGSHRTFSKEGVREIITIPHPRKDTSKGILRQVQKYTGMKLL

Download         Length: 189 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14882.74 Da        Isoelectric Point: 4.3708

>AT266239 WP_017491645.1 NZ_CP114062:c1258204-1257797 [Rouxiella badensis]
MIYPIFIFKSESGFDGYFPDVPGCFFSGDTLEDAVKDSEAAFGAHCDVLTERGDHVPAPADVSAYLGDERLIEDGGFLGF
VEIDPTKYESKAVKFNLTMPSNLIAAIDRFIEKNGQYKNRSAFLAELARKEIARG

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References