Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 21064..21583 Replicon plasmid pSP1
Accession NZ_CP114061
Organism Rouxiella badensis strain DAR84756

Toxin (Protein)


Gene name parE Uniprot ID Q70W48
Locus tag O1V65_RS00105 Protein ID WP_032490867.1
Coordinates 21064..21348 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag O1V65_RS00110 Protein ID WP_050915793.1
Coordinates 21341..21583 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1V65_RS00080 (O1V65_00080) 17493..18416 + 924 WP_269129747.1 recombinase family protein -
O1V65_RS00085 (O1V65_00085) 18704..19258 - 555 WP_050074634.1 hypothetical protein -
O1V65_RS00090 (O1V65_00090) 19261..19842 - 582 WP_255952134.1 ComF family protein -
O1V65_RS00095 (O1V65_00095) 20046..20666 + 621 WP_032490866.1 ParA family partition ATPase -
O1V65_RS00100 (O1V65_00100) 20706..20933 + 228 WP_008815937.1 plasmid partition protein ParG -
O1V65_RS00105 (O1V65_00105) 21064..21348 - 285 WP_032490867.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O1V65_RS00110 (O1V65_00110) 21341..21583 - 243 WP_050915793.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
O1V65_RS00115 (O1V65_00115) 22155..23072 - 918 WP_145548216.1 plasmid replication initiator RepA -
O1V65_RS00120 (O1V65_00120) 23580..23942 - 363 WP_057631486.1 helix-turn-helix transcriptional regulator -
O1V65_RS00125 (O1V65_00125) 24212..24667 + 456 WP_016361119.1 transcription termination/antitermination NusG family protein -
O1V65_RS00130 (O1V65_00130) 24746..24970 + 225 WP_008815931.1 hypothetical protein -
O1V65_RS00135 (O1V65_00135) 24991..25659 + 669 WP_032490873.1 lytic transglycosylase domain-containing protein -
O1V65_RS00140 (O1V65_00140) 25669..25962 + 294 WP_032490874.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..40722 40722


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10989.52 Da        Isoelectric Point: 6.2111

>T266238 WP_032490867.1 NZ_CP114061:c21348-21064 [Rouxiella badensis]
VYKLTERAAEDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHAVPGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8875.99 Da        Isoelectric Point: 5.8317

>AT266238 WP_050915793.1 NZ_CP114061:c21583-21341 [Rouxiella badensis]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVIAGLESGESSLSLRDIAAERKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377TBT2

Antitoxin

Source ID Structure

References