Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2766603..2767218 | Replicon | chromosome |
| Accession | NZ_CP114058 | ||
| Organism | Rouxiella chamberiensis strain DSM 28324 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1X0WJL4 |
| Locus tag | O1V66_RS12840 | Protein ID | WP_026110585.1 |
| Coordinates | 2767015..2767218 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | O1V66_RS12835 | Protein ID | WP_045046077.1 |
| Coordinates | 2766603..2766971 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1V66_RS12805 (O1V66_12805) | 2762473..2762727 | + | 255 | WP_045046083.1 | type B 50S ribosomal protein L31 | - |
| O1V66_RS12810 (O1V66_12810) | 2762746..2762889 | + | 144 | WP_045046082.1 | type B 50S ribosomal protein L36 | - |
| O1V66_RS12815 (O1V66_12815) | 2763023..2763901 | - | 879 | WP_045046081.1 | metal ABC transporter substrate-binding protein | - |
| O1V66_RS12820 (O1V66_12820) | 2763934..2764791 | - | 858 | WP_045046080.1 | metal ABC transporter permease | - |
| O1V66_RS12825 (O1V66_12825) | 2764788..2765525 | - | 738 | WP_045046079.1 | ABC transporter ATP-binding protein | - |
| O1V66_RS12830 (O1V66_12830) | 2765957..2766310 | + | 354 | WP_045046078.1 | hypothetical protein | - |
| O1V66_RS12835 (O1V66_12835) | 2766603..2766971 | + | 369 | WP_045046077.1 | Hha toxicity modulator TomB | Antitoxin |
| O1V66_RS12840 (O1V66_12840) | 2767015..2767218 | + | 204 | WP_026110585.1 | HHA domain-containing protein | Toxin |
| O1V66_RS12850 (O1V66_12850) | 2767794..2768102 | + | 309 | WP_045046076.1 | MGMT family protein | - |
| O1V66_RS12855 (O1V66_12855) | 2768189..2768755 | - | 567 | WP_045046075.1 | YbaY family lipoprotein | - |
| O1V66_RS12860 (O1V66_12860) | 2768980..2769846 | + | 867 | WP_045046074.1 | acyl-CoA thioesterase II | - |
| O1V66_RS12865 (O1V66_12865) | 2769943..2771229 | - | 1287 | WP_045046073.1 | ammonium transporter AmtB | - |
| O1V66_RS12870 (O1V66_12870) | 2771272..2771610 | - | 339 | WP_045046072.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8115.43 Da Isoelectric Point: 7.9892
>T266235 WP_026110585.1 NZ_CP114058:2767015-2767218 [Rouxiella chamberiensis]
MNKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELELFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MNKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELELFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.97 Da Isoelectric Point: 4.5844
>AT266235 WP_045046077.1 NZ_CP114058:2766603-2766971 [Rouxiella chamberiensis]
MDEYSPKRHDIAQLRFLNENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDETNLSDLVEEYL
DDTYTLFSNYGINDSDLRQWQKTKKRLFRMFSGDYVCALMKT
MDEYSPKRHDIAQLRFLNENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDETNLSDLVEEYL
DDTYTLFSNYGINDSDLRQWQKTKKRLFRMFSGDYVCALMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|