Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 328293..328926 Replicon chromosome
Accession NZ_CP114058
Organism Rouxiella chamberiensis strain DSM 28324

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag O1V66_RS01580 Protein ID WP_072045068.1
Coordinates 328293..328469 (+) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag O1V66_RS01585 Protein ID WP_045047467.1
Coordinates 328519..328926 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1V66_RS01545 (O1V66_01545) 323391..323600 + 210 WP_072045069.1 Cro/CI family transcriptional regulator -
O1V66_RS01550 (O1V66_01550) 323593..323772 + 180 WP_045047615.1 DUF4222 domain-containing protein -
O1V66_RS01555 (O1V66_01555) 323769..324611 + 843 Protein_295 helix-turn-helix domain-containing protein -
O1V66_RS01560 (O1V66_01560) 324604..325476 + 873 WP_045047471.1 ATP-binding protein -
O1V66_RS01565 (O1V66_01565) 325481..326845 + 1365 WP_045047470.1 replicative DNA helicase -
O1V66_RS01570 (O1V66_01570) 326845..327495 + 651 WP_269128039.1 helix-turn-helix domain-containing protein -
O1V66_RS01575 (O1V66_01575) 327703..328119 + 417 WP_045047468.1 antiterminator Q family protein -
O1V66_RS01580 (O1V66_01580) 328293..328469 + 177 WP_072045068.1 type II toxin-antitoxin system HicA family toxin Toxin
O1V66_RS01585 (O1V66_01585) 328519..328926 + 408 WP_045047467.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
O1V66_RS01590 (O1V66_01590) 329065..329352 - 288 WP_072045067.1 hypothetical protein -
O1V66_RS01595 (O1V66_01595) 329537..329785 + 249 WP_045047466.1 phage holin -
O1V66_RS01600 (O1V66_01600) 329794..330288 + 495 WP_187329799.1 lysozyme -
O1V66_RS01605 (O1V66_01605) 330383..330904 + 522 WP_269128040.1 hypothetical protein -
O1V66_RS01610 (O1V66_01610) 331133..331654 + 522 WP_269128041.1 hypothetical protein -
O1V66_RS01615 (O1V66_01615) 331684..332019 + 336 WP_269128042.1 hypothetical protein -
O1V66_RS01620 (O1V66_01620) 332183..332368 + 186 WP_269128043.1 hypothetical protein -
O1V66_RS01625 (O1V66_01625) 332362..332703 + 342 WP_152623596.1 HNH endonuclease signature motif containing protein -
O1V66_RS01630 (O1V66_01630) 332703..332900 + 198 WP_045047462.1 hypothetical protein -
O1V66_RS01635 (O1V66_01635) 333352..333525 + 174 WP_269128044.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 302420..358858 56438


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-63)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6875.07 Da        Isoelectric Point: 11.2038

>T266230 WP_072045068.1 NZ_CP114058:328293-328469 [Rouxiella chamberiensis]
VKQSEFRRWLESQGVEVYDGTKHLKLRFKGKRSVMPRHPGSELDDRLRKVILKQLGLK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14734.87 Da        Isoelectric Point: 4.1754

>AT266230 WP_045047467.1 NZ_CP114058:328519-328926 [Rouxiella chamberiensis]
MRYPVTLEPDNGVYLVQFPDIPEALTQGGSREEALEMALDALVTSFEFYFEDSEKVPAPSAVTGDYVEVPASVTAKVIML
NAFIDSGLTQIQLANAMGVKKQEVTRLFDLQHSTKIDTIQKALSALGKQLELVAV

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References