Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
| Location | 1924799..1925288 | Replicon | chromosome |
| Accession | NZ_CP114053 | ||
| Organism | Bifidobacterium longum subsp. infantis strain Y46 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | O0R44_RS08740 | Protein ID | WP_229773994.1 |
| Coordinates | 1924799..1925026 (-) | Length | 76 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A4V2N072 |
| Locus tag | O0R44_RS08745 | Protein ID | WP_032744823.1 |
| Coordinates | 1925052..1925288 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O0R44_RS08725 (O0R44_08725) | 1922022..1922744 | - | 723 | WP_032744819.1 | hypothetical protein | - |
| O0R44_RS08730 (O0R44_08730) | 1922809..1923765 | - | 957 | WP_032744820.1 | A/G-specific adenine glycosylase | - |
| O0R44_RS08735 (O0R44_08735) | 1923786..1924448 | + | 663 | WP_136527151.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| O0R44_RS08740 (O0R44_08740) | 1924799..1925026 | - | 228 | WP_229773994.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O0R44_RS08745 (O0R44_08745) | 1925052..1925288 | - | 237 | WP_032744823.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| O0R44_RS08750 (O0R44_08750) | 1925871..1926512 | - | 642 | WP_192575730.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
| O0R44_RS08755 (O0R44_08755) | 1926595..1927920 | - | 1326 | WP_230581269.1 | MFS transporter | - |
| O0R44_RS08760 (O0R44_08760) | 1927947..1929134 | - | 1188 | WP_032744825.1 | carboxylate--amine ligase | - |
| O0R44_RS08765 (O0R44_08765) | 1929136..1929735 | - | 600 | WP_269136706.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1924799..1937932 | 13133 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 76 a.a. Molecular weight: 8653.22 Da Isoelectric Point: 10.1818
>T266229 WP_229773994.1 NZ_CP114053:c1925026-1924799 [Bifidobacterium longum subsp. infantis]
MKKLDRNVAKRIIAKLREISQLEDPRSTGKALAGNLAGLWRYRVGDYRIVCDIEDEVLLILVIDVAHRSKVYKRC
MKKLDRNVAKRIIAKLREISQLEDPRSTGKALAGNLAGLWRYRVGDYRIVCDIEDEVLLILVIDVAHRSKVYKRC
Download Length: 228 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|