Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-RelB |
| Location | 1525718..1526267 | Replicon | chromosome |
| Accession | NZ_CP114053 | ||
| Organism | Bifidobacterium longum subsp. infantis strain Y46 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S2ZXD7 |
| Locus tag | O0R44_RS07020 | Protein ID | WP_003829109.1 |
| Coordinates | 1525944..1526267 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A0M4LW25 |
| Locus tag | O0R44_RS07015 | Protein ID | WP_032743660.1 |
| Coordinates | 1525718..1525957 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O0R44_RS06995 (O0R44_06995) | 1521562..1522224 | + | 663 | WP_032743761.1 | TetR/AcrR family transcriptional regulator | - |
| O0R44_RS07000 (O0R44_07000) | 1522381..1523652 | + | 1272 | WP_032743663.1 | MFS transporter | - |
| O0R44_RS07005 (O0R44_07005) | 1523836..1523964 | - | 129 | WP_032743662.1 | XRE family transcriptional regulator | - |
| O0R44_RS07010 (O0R44_07010) | 1524282..1525538 | - | 1257 | WP_032743661.1 | HipA domain-containing protein | - |
| O0R44_RS07015 (O0R44_07015) | 1525718..1525957 | + | 240 | WP_032743660.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| O0R44_RS07020 (O0R44_07020) | 1525944..1526267 | + | 324 | WP_003829109.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O0R44_RS07025 (O0R44_07025) | 1526484..1527098 | - | 615 | WP_080714683.1 | cupin domain-containing protein | - |
| O0R44_RS07030 (O0R44_07030) | 1527246..1527605 | - | 360 | WP_080714682.1 | class I SAM-dependent methyltransferase | - |
| O0R44_RS07035 (O0R44_07035) | 1527843..1528208 | + | 366 | WP_032743659.1 | YccF domain-containing protein | - |
| O0R44_RS07040 (O0R44_07040) | 1528750..1530015 | + | 1266 | WP_050496214.1 | Fic family protein | - |
| O0R44_RS07045 (O0R44_07045) | 1530485..1530774 | + | 290 | Protein_1366 | IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11859.67 Da Isoelectric Point: 5.0771
>T266228 WP_003829109.1 NZ_CP114053:1525944-1526267 [Bifidobacterium longum subsp. infantis]
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087B6Q7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M4LW25 |