Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-RelB
Location 1525718..1526267 Replicon chromosome
Accession NZ_CP114053
Organism Bifidobacterium longum subsp. infantis strain Y46

Toxin (Protein)


Gene name mazF Uniprot ID S2ZXD7
Locus tag O0R44_RS07020 Protein ID WP_003829109.1
Coordinates 1525944..1526267 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A0M4LW25
Locus tag O0R44_RS07015 Protein ID WP_032743660.1
Coordinates 1525718..1525957 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O0R44_RS06995 (O0R44_06995) 1521562..1522224 + 663 WP_032743761.1 TetR/AcrR family transcriptional regulator -
O0R44_RS07000 (O0R44_07000) 1522381..1523652 + 1272 WP_032743663.1 MFS transporter -
O0R44_RS07005 (O0R44_07005) 1523836..1523964 - 129 WP_032743662.1 XRE family transcriptional regulator -
O0R44_RS07010 (O0R44_07010) 1524282..1525538 - 1257 WP_032743661.1 HipA domain-containing protein -
O0R44_RS07015 (O0R44_07015) 1525718..1525957 + 240 WP_032743660.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O0R44_RS07020 (O0R44_07020) 1525944..1526267 + 324 WP_003829109.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
O0R44_RS07025 (O0R44_07025) 1526484..1527098 - 615 WP_080714683.1 cupin domain-containing protein -
O0R44_RS07030 (O0R44_07030) 1527246..1527605 - 360 WP_080714682.1 class I SAM-dependent methyltransferase -
O0R44_RS07035 (O0R44_07035) 1527843..1528208 + 366 WP_032743659.1 YccF domain-containing protein -
O0R44_RS07040 (O0R44_07040) 1528750..1530015 + 1266 WP_050496214.1 Fic family protein -
O0R44_RS07045 (O0R44_07045) 1530485..1530774 + 290 Protein_1366 IS256 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-54)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11859.67 Da        Isoelectric Point: 5.0771

>T266228 WP_003829109.1 NZ_CP114053:1525944-1526267 [Bifidobacterium longum subsp. infantis]
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL

Download         Length: 324 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9121.16 Da        Isoelectric Point: 4.5881

>AT266228 WP_032743660.1 NZ_CP114053:1525718-1525957 [Bifidobacterium longum subsp. infantis]
MQIATRVDDEQAALFKETTRQLGTTPADALRMFISAFNDYRGFPYEVRLPRNDVEPFASERDATEYASRLALRMSDETR

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A087B6Q7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M4LW25

References