Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1466625..1467264 | Replicon | chromosome |
Accession | NZ_CP114053 | ||
Organism | Bifidobacterium longum subsp. infantis strain Y46 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W6EZW1 |
Locus tag | O0R44_RS06725 | Protein ID | WP_014484977.1 |
Coordinates | 1466908..1467264 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | O0R44_RS06720 | Protein ID | WP_003829235.1 |
Coordinates | 1466625..1466921 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0R44_RS06695 (O0R44_06695) | 1462016..1464694 | - | 2679 | WP_032743694.1 | alanine--tRNA ligase | - |
O0R44_RS06700 (O0R44_06700) | 1464823..1465059 | - | 237 | WP_007053386.1 | hypothetical protein | - |
O0R44_RS06705 (O0R44_06705) | 1465059..1465457 | - | 399 | WP_032743693.1 | DUF948 domain-containing protein | - |
O0R44_RS06710 (O0R44_06710) | 1465540..1466214 | - | 675 | WP_032743692.1 | histidine phosphatase family protein | - |
O0R44_RS06715 (O0R44_06715) | 1466289..1466555 | + | 267 | WP_230581180.1 | hypothetical protein | - |
O0R44_RS06720 (O0R44_06720) | 1466625..1466921 | + | 297 | WP_003829235.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
O0R44_RS06725 (O0R44_06725) | 1466908..1467264 | + | 357 | WP_014484977.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
O0R44_RS06730 (O0R44_06730) | 1467539..1468141 | - | 603 | WP_032743691.1 | transglutaminase family protein | - |
O0R44_RS06735 (O0R44_06735) | 1468246..1468611 | - | 366 | WP_269136689.1 | SdpI family protein | - |
O0R44_RS06740 (O0R44_06740) | 1468496..1468885 | + | 390 | WP_230581178.1 | cytidine deaminase | - |
O0R44_RS06745 (O0R44_06745) | 1469023..1469805 | + | 783 | WP_032743690.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
O0R44_RS06750 (O0R44_06750) | 1469984..1470610 | - | 627 | WP_007052130.1 | 30S ribosomal protein S4 | - |
O0R44_RS06755 (O0R44_06755) | 1470809..1471801 | - | 993 | WP_080714690.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13302.25 Da Isoelectric Point: 8.9603
>T266227 WP_014484977.1 NZ_CP114053:1466908-1467264 [Bifidobacterium longum subsp. infantis]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|