Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 970035..970618 | Replicon | chromosome |
Accession | NZ_CP114053 | ||
Organism | Bifidobacterium longum subsp. infantis strain Y46 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A1S2VZ23 |
Locus tag | O0R44_RS04290 | Protein ID | WP_032745284.1 |
Coordinates | 970316..970618 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | I3AVV5 |
Locus tag | O0R44_RS04285 | Protein ID | WP_007057517.1 |
Coordinates | 970035..970319 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0R44_RS04260 (O0R44_04260) | 966179..966547 | - | 369 | WP_155270629.1 | hypothetical protein | - |
O0R44_RS04265 (O0R44_04265) | 966541..967623 | + | 1083 | Protein_822 | transposase | - |
O0R44_RS04270 (O0R44_04270) | 967721..968629 | + | 909 | WP_032744304.1 | ABC transporter ATP-binding protein | - |
O0R44_RS04275 (O0R44_04275) | 968626..969357 | + | 732 | WP_032744305.1 | ABC transporter permease | - |
O0R44_RS04280 (O0R44_04280) | 969375..969926 | - | 552 | Protein_825 | IS30 family transposase | - |
O0R44_RS04285 (O0R44_04285) | 970035..970319 | - | 285 | WP_007057517.1 | putative addiction module antidote protein | Antitoxin |
O0R44_RS04290 (O0R44_04290) | 970316..970618 | - | 303 | WP_032745284.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O0R44_RS04295 (O0R44_04295) | 970656..971090 | - | 435 | WP_230581286.1 | DUF1922 domain-containing protein | - |
O0R44_RS04300 (O0R44_04300) | 971111..971599 | + | 489 | WP_032745281.1 | D-aminoacyl-tRNA deacylase | - |
O0R44_RS04305 (O0R44_04305) | 971760..974879 | + | 3120 | WP_136527129.1 | alpha-mannosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 969375..969830 | 455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11350.08 Da Isoelectric Point: 10.4626
>T266225 WP_032745284.1 NZ_CP114053:c970618-970316 [Bifidobacterium longum subsp. infantis]
IKQSAEYRKWFKKLRDHKAKAAIQARLDACKLAGRPFGDIKPVGGPVSEMRFHTGAGYRVYFAMQGNVLMLLLAGGDKST
QQTDIRQAHDILNDYKEQRQ
IKQSAEYRKWFKKLRDHKAKAAIQARLDACKLAGRPFGDIKPVGGPVSEMRFHTGAGYRVYFAMQGNVLMLLLAGGDKST
QQTDIRQAHDILNDYKEQRQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2VZ23 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I3AVV5 |