Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3152635..3153552 | Replicon | chromosome |
Accession | NZ_CP114038 | ||
Organism | Bacillus velezensis strain B8 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | OZA25_RS15380 | Protein ID | WP_007407256.1 |
Coordinates | 3152635..3153381 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | OZA25_RS15385 | Protein ID | WP_003154807.1 |
Coordinates | 3153382..3153552 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZA25_RS15360 (OZA25_15360) | 3148028..3148978 | - | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
OZA25_RS15365 (OZA25_15365) | 3149300..3150616 | + | 1317 | WP_032874616.1 | amino acid permease | - |
OZA25_RS15370 (OZA25_15370) | 3150902..3151519 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
OZA25_RS15375 (OZA25_15375) | 3151532..3152530 | + | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
OZA25_RS15380 (OZA25_15380) | 3152635..3153381 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OZA25_RS15385 (OZA25_15385) | 3153382..3153552 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OZA25_RS15390 (OZA25_15390) | 3153649..3153774 | + | 126 | WP_003154809.1 | hypothetical protein | - |
OZA25_RS15395 (OZA25_15395) | 3153809..3154687 | - | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
OZA25_RS15400 (OZA25_15400) | 3154701..3154964 | - | 264 | WP_003154813.1 | phage holin | - |
OZA25_RS15405 (OZA25_15405) | 3154978..3155241 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
OZA25_RS15410 (OZA25_15410) | 3155293..3156054 | - | 762 | WP_032874607.1 | hypothetical protein | - |
OZA25_RS15415 (OZA25_15415) | 3156111..3156308 | - | 198 | WP_032874605.1 | XkdX family protein | - |
OZA25_RS15420 (OZA25_15420) | 3156313..3156684 | - | 372 | WP_032874603.1 | XkdW family protein | - |
OZA25_RS15425 (OZA25_15425) | 3156697..3158319 | - | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3144360..3197306 | 52946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T266222 WP_007407256.1 NZ_CP114038:3152635-3153381 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|