Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 3749060..3749631 | Replicon | chromosome |
Accession | NZ_CP114036 | ||
Organism | Streptomyces sp. S465 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | N6H00_RS15830 | Protein ID | WP_268972343.1 |
Coordinates | 3749060..3749434 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | N6H00_RS15835 | Protein ID | WP_268972344.1 |
Coordinates | 3749434..3749631 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H00_RS15815 (N6H00_15815) | 3744930..3745715 | - | 786 | WP_268972340.1 | S16 family serine protease | - |
N6H00_RS15820 (N6H00_15820) | 3746159..3746800 | - | 642 | WP_268972341.1 | helix-turn-helix domain-containing protein | - |
N6H00_RS15825 (N6H00_15825) | 3747153..3748949 | - | 1797 | WP_268972342.1 | DEAD/DEAH box helicase | - |
N6H00_RS15830 (N6H00_15830) | 3749060..3749434 | - | 375 | WP_268972343.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
N6H00_RS15835 (N6H00_15835) | 3749434..3749631 | - | 198 | WP_268972344.1 | Arc family DNA-binding protein | Antitoxin |
N6H00_RS15840 (N6H00_15840) | 3749665..3751116 | - | 1452 | WP_268972345.1 | MFS transporter | - |
N6H00_RS15845 (N6H00_15845) | 3751398..3752369 | - | 972 | WP_268976985.1 | putative sulfate exporter family transporter | - |
N6H00_RS15850 (N6H00_15850) | 3752450..3753019 | - | 570 | WP_268972346.1 | cysteine dioxygenase family protein | - |
N6H00_RS15855 (N6H00_15855) | 3753136..3754041 | - | 906 | WP_268972347.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13866.73 Da Isoelectric Point: 4.7156
>T266221 WP_268972343.1 NZ_CP114036:c3749434-3749060 [Streptomyces sp. S465]
MHYLTLPELLHLAERLGESEVRDYGLLESALARPQASVFGQDAYPDVWQKAAALMESLARNHALVDGNKRLSWYATWVFL
HINGHPLDAAFDVDEAERFVLGVCQGELDVPKIAEGLTRFTNGM
MHYLTLPELLHLAERLGESEVRDYGLLESALARPQASVFGQDAYPDVWQKAAALMESLARNHALVDGNKRLSWYATWVFL
HINGHPLDAAFDVDEAERFVLGVCQGELDVPKIAEGLTRFTNGM
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|