Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4686153..4686741 | Replicon | chromosome |
Accession | NZ_CP114035 | ||
Organism | Pseudomonas putida strain GMI12077 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OZ911_RS21420 | Protein ID | WP_023047767.1 |
Coordinates | 4686153..4686455 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OZ911_RS21425 | Protein ID | WP_016488543.1 |
Coordinates | 4686448..4686741 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ911_RS21395 (OZ911_21395) | 4682079..4682207 | - | 129 | WP_009683677.1 | PA1414 family protein | - |
OZ911_RS21400 (OZ911_21400) | 4682332..4683225 | - | 894 | WP_016488538.1 | LysR family transcriptional regulator | - |
OZ911_RS21405 (OZ911_21405) | 4683332..4684501 | + | 1170 | WP_070086856.1 | MFS transporter | - |
OZ911_RS21410 (OZ911_21410) | 4684549..4685475 | - | 927 | WP_023047766.1 | DMT family transporter | - |
OZ911_RS21415 (OZ911_21415) | 4685582..4685977 | - | 396 | WP_016498447.1 | hypothetical protein | - |
OZ911_RS21420 (OZ911_21420) | 4686153..4686455 | + | 303 | WP_023047767.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ911_RS21425 (OZ911_21425) | 4686448..4686741 | + | 294 | WP_016488543.1 | putative addiction module antidote protein | Antitoxin |
OZ911_RS21430 (OZ911_21430) | 4686831..4687103 | + | 273 | WP_016488544.1 | hypothetical protein | - |
OZ911_RS21435 (OZ911_21435) | 4687225..4688586 | - | 1362 | WP_023047768.1 | DEAD/DEAH box helicase | - |
OZ911_RS21440 (OZ911_21440) | 4688690..4689991 | + | 1302 | WP_016488546.1 | mechanosensitive ion channel family protein | - |
OZ911_RS21445 (OZ911_21445) | 4690100..4691035 | - | 936 | WP_023047769.1 | AEC family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11337.04 Da Isoelectric Point: 10.8638
>T266219 WP_023047767.1 NZ_CP114035:4686153-4686455 [Pseudomonas putida]
MKKIESSSFRHWVTGLRDLSARARIISRINRLMEGLPGDGSPVGHGVSELKIHYGPGYRVYFHQTGSTFVILLCGGDKSS
QKRDIKVAHQILRSWRMQND
MKKIESSSFRHWVTGLRDLSARARIISRINRLMEGLPGDGSPVGHGVSELKIHYGPGYRVYFHQTGSTFVILLCGGDKSS
QKRDIKVAHQILRSWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|