Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
| Location | 5370394..5371029 | Replicon | chromosome |
| Accession | NZ_CP114031 | ||
| Organism | Paenibacillus thiaminolyticus strain PATH554 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | O0V01_RS24260 | Protein ID | WP_087444735.1 |
| Coordinates | 5370394..5370744 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A2W4HCL7 |
| Locus tag | O0V01_RS24265 | Protein ID | WP_040731899.1 |
| Coordinates | 5370748..5371029 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O0V01_RS24250 (O0V01_24265) | 5367408..5368310 | + | 903 | WP_284655322.1 | hypothetical protein | - |
| O0V01_RS24255 (O0V01_24270) | 5368273..5369877 | + | 1605 | WP_284655323.1 | M60 family metallopeptidase | - |
| O0V01_RS24260 (O0V01_24275) | 5370394..5370744 | - | 351 | WP_087444735.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O0V01_RS24265 (O0V01_24280) | 5370748..5371029 | - | 282 | WP_040731899.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| O0V01_RS24270 (O0V01_24285) | 5371280..5372473 | - | 1194 | WP_284655325.1 | alanine racemase | - |
| O0V01_RS24275 (O0V01_24290) | 5372715..5373833 | - | 1119 | WP_284655326.1 | DUF4367 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12862.87 Da Isoelectric Point: 5.6312
>T266216 WP_087444735.1 NZ_CP114031:c5370744-5370394 [Paenibacillus thiaminolyticus]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRKVDDGLLISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRKVDDGLLISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|