Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 68488..69074 Replicon plasmid unnamed2
Accession NZ_CP114030
Organism Jiella sp. HL-NP1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OH818_RS28220 Protein ID WP_083591586.1
Coordinates 68820..69074 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OH818_RS28215 Protein ID WP_083591587.1
Coordinates 68488..68823 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH818_RS28195 (OH818_28215) 66174..66449 - 276 WP_083591591.1 VirB3 family type IV secretion system protein -
OH818_RS28200 (OH818_28220) 66446..66736 - 291 WP_083591590.1 TrbC/VirB2 family protein -
OH818_RS28205 (OH818_28225) 66721..67407 - 687 WP_083591589.1 lytic transglycosylase domain-containing protein -
OH818_RS28210 (OH818_28230) 67808..68101 - 294 WP_268883963.1 hypothetical protein -
OH818_RS28215 (OH818_28235) 68488..68823 - 336 WP_083591587.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OH818_RS28220 (OH818_28240) 68820..69074 - 255 WP_083591586.1 type II toxin-antitoxin system HicA family toxin Toxin
OH818_RS28225 (OH818_28245) 69225..69668 - 444 WP_083591585.1 hypothetical protein -
OH818_RS28230 (OH818_28250) 69652..70312 - 661 Protein_76 recombinase family protein -
OH818_RS28235 (OH818_28255) 70552..70857 + 306 WP_268883964.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
OH818_RS28240 (OH818_28260) 70854..71249 + 396 WP_083591583.1 type II toxin-antitoxin system VapC family toxin -
OH818_RS28245 (OH818_28265) 71456..71842 + 387 WP_083591582.1 fluoride efflux transporter CrcB -
OH818_RS28250 (OH818_28270) 71857..72612 + 756 WP_083591581.1 phosphatase PAP2 family protein -
OH818_RS28255 (OH818_28275) 72609..73046 + 438 WP_083591580.1 EamA family transporter -
OH818_RS28260 (OH818_28280) 73050..73647 + 598 Protein_82 cation transporter -
OH818_RS28265 (OH818_28285) 73754..73903 - 150 Protein_83 methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..151058 151058


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(24-73)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9358.80 Da        Isoelectric Point: 9.9396

>T266215 WP_083591586.1 NZ_CP114030:c69074-68820 [Jiella sp. HL-NP1]
MNSKQKKTLAAVFREPVPGTLEWAAIEGLLVAAGCRIIEGSGSRVRFEKDGELESFHRPHPAKEAERYQVRAARAFLIRL
GIEP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12218.78 Da        Isoelectric Point: 5.1737

>AT266215 WP_083591587.1 NZ_CP114030:c68823-68488 [Jiella sp. HL-NP1]
MTNIITYKGYAARVEYDDEDGILFGQIAGIRDGVGFHAESVEELRTAFHEAVDDYLATCATIGKEPQKPYSGKMMFRVSP
EIHRKAAIAAELAGKSLNQWAEEALSKAIHS

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References