Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 3737573..3738138 | Replicon | chromosome |
Accession | NZ_CP114029 | ||
Organism | Jiella sp. HL-NP1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OH818_RS19035 | Protein ID | WP_268880043.1 |
Coordinates | 3737573..3737947 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OH818_RS19040 | Protein ID | WP_233717942.1 |
Coordinates | 3737947..3738138 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH818_RS19015 (OH818_19025) | 3733507..3734243 | - | 737 | Protein_3538 | response regulator transcription factor | - |
OH818_RS19020 (OH818_19030) | 3735022..3735432 | + | 411 | WP_268880040.1 | hypothetical protein | - |
OH818_RS19025 (OH818_19035) | 3735669..3736340 | - | 672 | WP_268880041.1 | DUF1045 domain-containing protein | - |
OH818_RS19030 (OH818_19040) | 3736670..3737542 | + | 873 | WP_268880042.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
OH818_RS19035 (OH818_19045) | 3737573..3737947 | - | 375 | WP_268880043.1 | VapC toxin family PIN domain ribonuclease | Toxin |
OH818_RS19040 (OH818_19050) | 3737947..3738138 | - | 192 | WP_233717942.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH818_RS19045 (OH818_19055) | 3738320..3739525 | - | 1206 | WP_268880044.1 | translocation/assembly module TamB domain-containing protein | - |
OH818_RS19050 (OH818_19060) | 3739554..3739778 | + | 225 | WP_268880045.1 | hypothetical protein | - |
OH818_RS19055 (OH818_19065) | 3739906..3740505 | - | 600 | WP_268880046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13902.18 Da Isoelectric Point: 5.1138
>T266214 WP_268880043.1 NZ_CP114029:c3737947-3737573 [Jiella sp. HL-NP1]
MIIADTSIWVDHLRLGDDVLADLLLANQIAGHPYVIAELALGSIRDRDKFLAMIEGLPTVLPTPLPDLREHIEQHRLYRR
GIGFVDVALVTICLSDPNLRLWTRDKRLASIALELQIAFSPQAD
MIIADTSIWVDHLRLGDDVLADLLLANQIAGHPYVIAELALGSIRDRDKFLAMIEGLPTVLPTPLPDLREHIEQHRLYRR
GIGFVDVALVTICLSDPNLRLWTRDKRLASIALELQIAFSPQAD
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|