Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 637072..637703 | Replicon | chromosome |
Accession | NZ_CP114029 | ||
Organism | Jiella sp. HL-NP1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OH818_RS04320 | Protein ID | WP_268881926.1 |
Coordinates | 637072..637470 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OH818_RS04325 | Protein ID | WP_268881927.1 |
Coordinates | 637470..637703 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH818_RS04305 (OH818_04320) | 633055..634069 | + | 1015 | Protein_625 | alpha-ketoacid dehydrogenase subunit beta | - |
OH818_RS04310 (OH818_04325) | 634071..635468 | + | 1398 | WP_268881924.1 | dihydrolipoamide acetyltransferase family protein | - |
OH818_RS04315 (OH818_04330) | 635465..636862 | + | 1398 | WP_268881925.1 | dihydrolipoyl dehydrogenase | - |
OH818_RS04320 (OH818_04335) | 637072..637470 | - | 399 | WP_268881926.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH818_RS04325 (OH818_04340) | 637470..637703 | - | 234 | WP_268881927.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH818_RS04330 (OH818_04345) | 637827..638183 | - | 357 | WP_268881928.1 | tRNA-binding protein | - |
OH818_RS04335 (OH818_04350) | 638235..639041 | - | 807 | WP_268883609.1 | pyrroline-5-carboxylate reductase | - |
OH818_RS04340 (OH818_04355) | 639058..639558 | - | 501 | WP_268881929.1 | YbjN domain-containing protein | - |
OH818_RS04345 (OH818_04360) | 639842..640117 | - | 276 | WP_268881930.1 | accessory factor UbiK family protein | - |
OH818_RS04350 (OH818_04365) | 640346..641236 | + | 891 | WP_268881931.1 | prolipoprotein diacylglyceryl transferase | - |
OH818_RS04355 (OH818_04370) | 641233..642336 | + | 1104 | WP_268881932.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14818.13 Da Isoelectric Point: 7.7727
>T266212 WP_268881926.1 NZ_CP114029:c637470-637072 [Jiella sp. HL-NP1]
MLAYMLDTNICIHVMKTYPPQVREKFNALAEQLCISSITLGELHYGAQKSARCAKNLTAIEHFVARLEVLPFADKAAVHY
GQLRAELERAGTPCGPHDMQIGAHARSEGLIVVTNNRREFDRMPGLRAENWL
MLAYMLDTNICIHVMKTYPPQVREKFNALAEQLCISSITLGELHYGAQKSARCAKNLTAIEHFVARLEVLPFADKAAVHY
GQLRAELERAGTPCGPHDMQIGAHARSEGLIVVTNNRREFDRMPGLRAENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|