Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/MazF(toxin)
Location 2376749..2377341 Replicon chromosome
Accession NZ_CP113980
Organism Listeria newyorkensis strain CMB191063

Toxin (Protein)


Gene name pemK Uniprot ID A0A841YXR9
Locus tag OTR81_RS11330 Protein ID WP_036079839.1
Coordinates 2376997..2377341 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag OTR81_RS11325 Protein ID WP_220132333.1
Coordinates 2376749..2376988 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OTR81_RS11305 (OTR81_00220) 2372133..2373605 + 1473 WP_036091286.1 PH domain-containing protein -
OTR81_RS11310 (OTR81_00215) 2373637..2375025 + 1389 WP_036091288.1 protoporphyrinogen oxidase -
OTR81_RS11315 (OTR81_00210) 2375022..2375405 + 384 WP_036091290.1 holo-ACP synthase -
OTR81_RS11320 (OTR81_00205) 2375396..2376493 + 1098 WP_036091292.1 alanine racemase -
OTR81_RS11325 (OTR81_00200) 2376749..2376988 + 240 WP_220132333.1 CopG family transcriptional regulator Antitoxin
OTR81_RS11330 (OTR81_00195) 2376997..2377341 + 345 WP_036079839.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OTR81_RS11335 (OTR81_00190) 2377654..2378493 + 840 WP_036091295.1 RsbT co-antagonist protein RsbRA -
OTR81_RS11340 (OTR81_00185) 2378498..2378854 + 357 WP_036073255.1 STAS domain-containing protein -
OTR81_RS11345 (OTR81_00180) 2378857..2379267 + 411 WP_036091297.1 anti-sigma regulatory factor -
OTR81_RS11350 (OTR81_00175) 2379283..2380296 + 1014 WP_036091299.1 PP2C family protein-serine/threonine phosphatase -
OTR81_RS11355 (OTR81_00170) 2380352..2380696 + 345 WP_036091300.1 STAS domain-containing protein -
OTR81_RS11360 (OTR81_00165) 2380680..2381153 + 474 WP_036091302.1 anti-sigma B factor RsbW -
OTR81_RS11365 (OTR81_00160) 2381131..2381937 + 807 WP_036091304.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-108)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 12625.60 Da        Isoelectric Point: 8.5681

>T266209 WP_036079839.1 NZ_CP113980:2376997-2377341 [Listeria newyorkensis]
MVKRGDVYYADLSPVVGSEQGGIRPVLVIQNDIGNRFSPTVIVAAITAKISKAKLPTHVEAARKHGFDRDSVILLEQVRT
IDKQRLTDKITHLDDNLMNQVNKALEISMGLVDF

Download         Length: 345 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9114.25 Da        Isoelectric Point: 4.4290

>AT266209 WP_220132333.1 NZ_CP113980:2376749-2376988 [Listeria newyorkensis]
MTQQVLDDLDEARAKEKMGRSEMIMEATQQFLRQRKARDLRDEMERGYTEMASINFSIACECTHVESEAEDKNLQVLGG

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A841YXR9

Antitoxin

Source ID Structure

References