Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2376749..2377341 | Replicon | chromosome |
Accession | NZ_CP113980 | ||
Organism | Listeria newyorkensis strain CMB191063 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A841YXR9 |
Locus tag | OTR81_RS11330 | Protein ID | WP_036079839.1 |
Coordinates | 2376997..2377341 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OTR81_RS11325 | Protein ID | WP_220132333.1 |
Coordinates | 2376749..2376988 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OTR81_RS11305 (OTR81_00220) | 2372133..2373605 | + | 1473 | WP_036091286.1 | PH domain-containing protein | - |
OTR81_RS11310 (OTR81_00215) | 2373637..2375025 | + | 1389 | WP_036091288.1 | protoporphyrinogen oxidase | - |
OTR81_RS11315 (OTR81_00210) | 2375022..2375405 | + | 384 | WP_036091290.1 | holo-ACP synthase | - |
OTR81_RS11320 (OTR81_00205) | 2375396..2376493 | + | 1098 | WP_036091292.1 | alanine racemase | - |
OTR81_RS11325 (OTR81_00200) | 2376749..2376988 | + | 240 | WP_220132333.1 | CopG family transcriptional regulator | Antitoxin |
OTR81_RS11330 (OTR81_00195) | 2376997..2377341 | + | 345 | WP_036079839.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OTR81_RS11335 (OTR81_00190) | 2377654..2378493 | + | 840 | WP_036091295.1 | RsbT co-antagonist protein RsbRA | - |
OTR81_RS11340 (OTR81_00185) | 2378498..2378854 | + | 357 | WP_036073255.1 | STAS domain-containing protein | - |
OTR81_RS11345 (OTR81_00180) | 2378857..2379267 | + | 411 | WP_036091297.1 | anti-sigma regulatory factor | - |
OTR81_RS11350 (OTR81_00175) | 2379283..2380296 | + | 1014 | WP_036091299.1 | PP2C family protein-serine/threonine phosphatase | - |
OTR81_RS11355 (OTR81_00170) | 2380352..2380696 | + | 345 | WP_036091300.1 | STAS domain-containing protein | - |
OTR81_RS11360 (OTR81_00165) | 2380680..2381153 | + | 474 | WP_036091302.1 | anti-sigma B factor RsbW | - |
OTR81_RS11365 (OTR81_00160) | 2381131..2381937 | + | 807 | WP_036091304.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12625.60 Da Isoelectric Point: 8.5681
>T266209 WP_036079839.1 NZ_CP113980:2376997-2377341 [Listeria newyorkensis]
MVKRGDVYYADLSPVVGSEQGGIRPVLVIQNDIGNRFSPTVIVAAITAKISKAKLPTHVEAARKHGFDRDSVILLEQVRT
IDKQRLTDKITHLDDNLMNQVNKALEISMGLVDF
MVKRGDVYYADLSPVVGSEQGGIRPVLVIQNDIGNRFSPTVIVAAITAKISKAKLPTHVEAARKHGFDRDSVILLEQVRT
IDKQRLTDKITHLDDNLMNQVNKALEISMGLVDF
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|