Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-MazE |
Location | 1002398..1002972 | Replicon | chromosome |
Accession | NZ_CP113980 | ||
Organism | Listeria newyorkensis strain CMB191063 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OTR81_RS04910 | Protein ID | WP_036090226.1 |
Coordinates | 1002634..1002972 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A3N9TRL1 |
Locus tag | OTR81_RS04905 | Protein ID | WP_036090223.1 |
Coordinates | 1002398..1002640 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OTR81_RS04880 (OTR81_06660) | 997417..998523 | - | 1107 | WP_036090213.1 | PTS fructose transporter subunit IIC | - |
OTR81_RS04885 (OTR81_06655) | 998536..998856 | - | 321 | WP_036060685.1 | PTS fructose transporter subunit IIB | - |
OTR81_RS04890 (OTR81_06650) | 998853..999317 | - | 465 | WP_036090216.1 | PTS sugar transporter subunit IIA | - |
OTR81_RS04895 (OTR81_06645) | 999317..1001272 | - | 1956 | WP_036090218.1 | BglG family transcription antiterminator | - |
OTR81_RS04900 (OTR81_06640) | 1001430..1002287 | + | 858 | WP_036090220.1 | GRP family sugar transporter | - |
OTR81_RS04905 (OTR81_06635) | 1002398..1002640 | + | 243 | WP_036090223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OTR81_RS04910 (OTR81_06630) | 1002634..1002972 | + | 339 | WP_036090226.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OTR81_RS04915 (OTR81_06625) | 1003484..1003855 | - | 372 | WP_036090230.1 | hypothetical protein | - |
OTR81_RS04920 (OTR81_16070) | 1004092..1004196 | + | 105 | WP_112859886.1 | type I toxin-antitoxin system Fst family toxin | - |
OTR81_RS04925 (OTR81_06620) | 1004501..1006045 | - | 1545 | WP_036090232.1 | gluconokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12796.78 Da Isoelectric Point: 9.7794
>T266208 WP_036090226.1 NZ_CP113980:1002634-1002972 [Listeria newyorkensis]
MVRQGDIIKINLNPKQGHEQQGYRPYICLSHRLVSEHANIAIFAPISNTPRSYPLYVPLIDTETTGKVLLDQLVTIDYNA
RKYNYVETVSDHLLNKLLKSVKVIFQKNASSK
MVRQGDIIKINLNPKQGHEQQGYRPYICLSHRLVSEHANIAIFAPISNTPRSYPLYVPLIDTETTGKVLLDQLVTIDYNA
RKYNYVETVSDHLLNKLLKSVKVIFQKNASSK
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|