Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3761110..3761750 Replicon chromosome
Accession NZ_CP113974
Organism Pseudomonas aeruginosa strain M6A146

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OZ175_RS17685 Protein ID WP_003105740.1
Coordinates 3761110..3761520 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q6X2S2
Locus tag OZ175_RS17690 Protein ID WP_003158175.1
Coordinates 3761520..3761750 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZ175_RS17645 (OZ175_17645) 3756979..3757149 + 171 WP_003159716.1 hypothetical protein -
OZ175_RS17650 (OZ175_17650) 3757305..3758033 + 729 WP_003105754.1 TIGR03761 family integrating conjugative element protein -
OZ175_RS17655 (OZ175_17655) 3758039..3758587 + 549 WP_003105753.1 DUF3158 family protein -
OZ175_RS17660 (OZ175_17660) 3758634..3759473 + 840 WP_003105750.1 Rha family transcriptional regulator -
OZ175_RS17665 (OZ175_17665) 3759503..3759991 + 489 WP_003105748.1 single-stranded DNA-binding protein -
OZ175_RS17670 (OZ175_17670) 3760147..3760344 + 198 WP_003109353.1 CrpP family ICE-associated protein -
OZ175_RS17675 (OZ175_17675) 3760410..3760628 - 219 WP_003105747.1 hypothetical protein -
OZ175_RS17680 (OZ175_17680) 3760828..3761088 - 261 WP_003105742.1 hypothetical protein -
OZ175_RS17685 (OZ175_17685) 3761110..3761520 - 411 WP_003105740.1 tRNA(fMet)-specific endonuclease VapC Toxin
OZ175_RS17690 (OZ175_17690) 3761520..3761750 - 231 WP_003158175.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OZ175_RS17695 (OZ175_17695) 3762006..3763925 + 1920 WP_004352838.1 type I DNA topoisomerase -
OZ175_RS17700 (OZ175_17700) 3764233..3764442 + 210 WP_003105733.1 cold-shock protein -
OZ175_RS17705 (OZ175_17705) 3764663..3766552 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 3741539..3845118 103579


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15450.81 Da        Isoelectric Point: 7.3233

>T266204 WP_003105740.1 NZ_CP113974:c3761520-3761110 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8480.41 Da        Isoelectric Point: 4.2821

>AT266204 WP_003158175.1 NZ_CP113974:c3761750-3761520 [Pseudomonas aeruginosa]
MEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVVVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6X2S2

References