Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3761110..3761750 | Replicon | chromosome |
| Accession | NZ_CP113974 | ||
| Organism | Pseudomonas aeruginosa strain M6A146 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OZ175_RS17685 | Protein ID | WP_003105740.1 |
| Coordinates | 3761110..3761520 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q6X2S2 |
| Locus tag | OZ175_RS17690 | Protein ID | WP_003158175.1 |
| Coordinates | 3761520..3761750 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZ175_RS17645 (OZ175_17645) | 3756979..3757149 | + | 171 | WP_003159716.1 | hypothetical protein | - |
| OZ175_RS17650 (OZ175_17650) | 3757305..3758033 | + | 729 | WP_003105754.1 | TIGR03761 family integrating conjugative element protein | - |
| OZ175_RS17655 (OZ175_17655) | 3758039..3758587 | + | 549 | WP_003105753.1 | DUF3158 family protein | - |
| OZ175_RS17660 (OZ175_17660) | 3758634..3759473 | + | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| OZ175_RS17665 (OZ175_17665) | 3759503..3759991 | + | 489 | WP_003105748.1 | single-stranded DNA-binding protein | - |
| OZ175_RS17670 (OZ175_17670) | 3760147..3760344 | + | 198 | WP_003109353.1 | CrpP family ICE-associated protein | - |
| OZ175_RS17675 (OZ175_17675) | 3760410..3760628 | - | 219 | WP_003105747.1 | hypothetical protein | - |
| OZ175_RS17680 (OZ175_17680) | 3760828..3761088 | - | 261 | WP_003105742.1 | hypothetical protein | - |
| OZ175_RS17685 (OZ175_17685) | 3761110..3761520 | - | 411 | WP_003105740.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| OZ175_RS17690 (OZ175_17690) | 3761520..3761750 | - | 231 | WP_003158175.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OZ175_RS17695 (OZ175_17695) | 3762006..3763925 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| OZ175_RS17700 (OZ175_17700) | 3764233..3764442 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| OZ175_RS17705 (OZ175_17705) | 3764663..3766552 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3741539..3845118 | 103579 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15450.81 Da Isoelectric Point: 7.3233
>T266204 WP_003105740.1 NZ_CP113974:c3761520-3761110 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|