Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 1060736..1061778 | Replicon | chromosome |
Accession | NZ_CP113974 | ||
Organism | Pseudomonas aeruginosa strain M6A146 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | OZ175_RS05245 | Protein ID | WP_003050248.1 |
Coordinates | 1061203..1061778 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | OZ175_RS05240 | Protein ID | WP_003050245.1 |
Coordinates | 1060736..1061206 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ175_RS05205 (OZ175_05205) | 1056126..1057545 | - | 1420 | Protein_1020 | TIGR03752 family integrating conjugative element protein | - |
OZ175_RS05210 (OZ175_05210) | 1057535..1058446 | - | 912 | WP_023087298.1 | TIGR03749 family integrating conjugative element protein | - |
OZ175_RS05215 (OZ175_05215) | 1058443..1059135 | - | 693 | WP_023087299.1 | TIGR03746 family integrating conjugative element protein | - |
OZ175_RS05220 (OZ175_05220) | 1059132..1059530 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
OZ175_RS05225 (OZ175_05225) | 1059543..1059902 | - | 360 | WP_021195311.1 | TIGR03745 family integrating conjugative element membrane protein | - |
OZ175_RS05230 (OZ175_05230) | 1059919..1060152 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
OZ175_RS05235 (OZ175_05235) | 1060149..1060532 | - | 384 | WP_023087300.1 | RAQPRD family integrative conjugative element protein | - |
OZ175_RS05240 (OZ175_05240) | 1060736..1061206 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
OZ175_RS05245 (OZ175_05245) | 1061203..1061778 | + | 576 | WP_003050248.1 | PIN domain-containing protein | Toxin |
OZ175_RS05250 (OZ175_05250) | 1061796..1062710 | + | 915 | WP_023087301.1 | AAA family ATPase | - |
OZ175_RS05255 (OZ175_05255) | 1062707..1063177 | + | 471 | WP_023087302.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
OZ175_RS05260 (OZ175_05260) | 1063174..1063674 | + | 501 | WP_003050262.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
OZ175_RS05265 (OZ175_05265) | 1063674..1064576 | + | 903 | WP_023087303.1 | CBASS oligonucleotide cyclase | - |
OZ175_RS05270 (OZ175_05270) | 1064613..1065338 | + | 726 | WP_023087304.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 992049..1107265 | 115216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21630.76 Da Isoelectric Point: 5.6130
>T266201 WP_003050248.1 NZ_CP113974:1061203-1061778 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT266201 WP_003050245.1 NZ_CP113974:1060736-1061206 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|