Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 1418062..1418700 | Replicon | chromosome |
Accession | NZ_CP113973 | ||
Organism | Paenibacillus polymyxa strain P3 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | H6CFY1 |
Locus tag | OYT09_RS06410 | Protein ID | WP_007429335.1 |
Coordinates | 1418350..1418700 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | H6CFY0 |
Locus tag | OYT09_RS06405 | Protein ID | WP_007429334.1 |
Coordinates | 1418062..1418343 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OYT09_RS06385 (OYT09_06390) | 1413392..1414384 | - | 993 | WP_272640114.1 | ABC transporter substrate-binding protein | - |
OYT09_RS06390 (OYT09_06395) | 1414619..1414936 | + | 318 | Protein_1223 | LysE family transporter | - |
OYT09_RS06395 (OYT09_06400) | 1415037..1416314 | + | 1278 | WP_272640115.1 | DUF4367 domain-containing protein | - |
OYT09_RS06400 (OYT09_06405) | 1416572..1417768 | + | 1197 | WP_272640116.1 | alanine racemase | - |
OYT09_RS06405 (OYT09_06410) | 1418062..1418343 | + | 282 | WP_007429334.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
OYT09_RS06410 (OYT09_06415) | 1418350..1418700 | + | 351 | WP_007429335.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OYT09_RS06415 (OYT09_06420) | 1418880..1421102 | + | 2223 | WP_272640863.1 | Tex family protein | - |
OYT09_RS06420 (OYT09_06425) | 1421207..1421341 | - | 135 | WP_007429337.1 | cortex morphogenetic protein CmpA | - |
OYT09_RS06425 (OYT09_06430) | 1421486..1421998 | + | 513 | WP_272640117.1 | SprT family protein | - |
OYT09_RS06440 (OYT09_06445) | 1422388..1423263 | - | 876 | WP_272640118.1 | Cof-type HAD-IIB family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12822.77 Da Isoelectric Point: 5.6195
>T266198 WP_007429335.1 NZ_CP113973:1418350-1418700 [Paenibacillus polymyxa]
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDEETMRKVSDSLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDEETMRKVSDSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|