Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1717530..1718049 | Replicon | chromosome |
Accession | NZ_CP113954 | ||
Organism | Streptococcus gallolyticus strain XH2168 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F5WVW3 |
Locus tag | OIY87_RS08610 | Protein ID | WP_012962242.1 |
Coordinates | 1717530..1717808 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | F5WVW4 |
Locus tag | OIY87_RS08615 | Protein ID | WP_012962243.1 |
Coordinates | 1717801..1718049 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIY87_RS08585 (OIY87_09900) | 1712847..1713455 | - | 609 | WP_009854651.1 | VTT domain-containing protein | - |
OIY87_RS08590 (OIY87_09905) | 1713703..1714005 | - | 303 | WP_009854652.1 | PepSY domain-containing protein | - |
OIY87_RS08595 (OIY87_09910) | 1714248..1715780 | - | 1533 | WP_269724885.1 | HAMP domain-containing sensor histidine kinase | - |
OIY87_RS08600 (OIY87_09915) | 1715725..1716451 | - | 727 | Protein_1633 | response regulator transcription factor | - |
OIY87_RS08605 (OIY87_09920) | 1716523..1717401 | - | 879 | WP_012962241.1 | DUF3114 domain-containing protein | - |
OIY87_RS08610 (OIY87_09925) | 1717530..1717808 | - | 279 | WP_012962242.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OIY87_RS08615 (OIY87_09930) | 1717801..1718049 | - | 249 | WP_012962243.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OIY87_RS08620 (OIY87_09935) | 1718377..1718895 | + | 519 | WP_009854658.1 | TetR/AcrR family transcriptional regulator | - |
OIY87_RS08625 (OIY87_09940) | 1719009..1720778 | + | 1770 | Protein_1638 | oleate hydratase | - |
OIY87_RS08630 (OIY87_09945) | 1720908..1721732 | - | 825 | WP_269725230.1 | class C sortase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11043.84 Da Isoelectric Point: 9.3104
>T266196 WP_012962242.1 NZ_CP113954:c1717808-1717530 [Streptococcus gallolyticus]
MLKIKYHRQFKRDYKLALKRGLKASKLEEVLEILIKGESLPEKYRDHQLVASKYYQNVRECHIQPDWLLIYQIDDDNLIL
NLVRTGSHSDLF
MLKIKYHRQFKRDYKLALKRGLKASKLEEVLEILIKGESLPEKYRDHQLVASKYYQNVRECHIQPDWLLIYQIDDDNLIL
NLVRTGSHSDLF
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|