Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1588521..1589101 | Replicon | chromosome |
Accession | NZ_CP113954 | ||
Organism | Streptococcus gallolyticus strain XH2168 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | F5WVJ0 |
Locus tag | OIY87_RS07995 | Protein ID | WP_009854536.1 |
Coordinates | 1588913..1589101 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OIY87_RS07990 | Protein ID | WP_009854535.1 |
Coordinates | 1588521..1588901 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIY87_RS07985 (OIY87_09300) | 1586277..1586693 | - | 417 | WP_269724858.1 | nucleoside-diphosphate kinase | - |
OIY87_RS07990 (OIY87_09305) | 1588521..1588901 | - | 381 | WP_009854535.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OIY87_RS07995 (OIY87_09310) | 1588913..1589101 | - | 189 | WP_009854536.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OIY87_RS08000 (OIY87_09315) | 1589197..1589862 | - | 666 | WP_172855736.1 | type II-A CRISPR-associated protein Csn2 | - |
OIY87_RS08005 (OIY87_09320) | 1589849..1590193 | - | 345 | WP_009854538.1 | CRISPR-associated endonuclease Cas2 | - |
OIY87_RS08010 (OIY87_09325) | 1590190..1591056 | - | 867 | WP_009854539.1 | type II CRISPR-associated endonuclease Cas1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6837.25 Da Isoelectric Point: 10.8207
>T266195 WP_009854536.1 NZ_CP113954:c1589101-1588913 [Streptococcus gallolyticus]
VPLTGRELAKLAVLKGWKEVRVKGSHHQFKKDGVPYILTIPIHGNKVLGVGLEKKILKDIGL
VPLTGRELAKLAVLKGWKEVRVKGSHHQFKKDGVPYILTIPIHGNKVLGVGLEKKILKDIGL
Download Length: 189 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14141.02 Da Isoelectric Point: 4.2393
>AT266195 WP_009854535.1 NZ_CP113954:c1588901-1588521 [Streptococcus gallolyticus]
MLKSYPAIFHKEDDGSFWVEFPGFGGGTEGDDVEEAMKNAREMLESSLAAYLDEGLELPKVVNMSELSVEDGFITLIQAD
PSPYLKSTKAIRKNVTVPEWLVRLADRENVNYSEVLTQALEKKLQL
MLKSYPAIFHKEDDGSFWVEFPGFGGGTEGDDVEEAMKNAREMLESSLAAYLDEGLELPKVVNMSELSVEDGFITLIQAD
PSPYLKSTKAIRKNVTVPEWLVRLADRENVNYSEVLTQALEKKLQL
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|