Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/- |
Location | 1352472..1353565 | Replicon | chromosome |
Accession | NZ_CP113954 | ||
Organism | Streptococcus gallolyticus strain XH2168 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | OIY87_RS06840 | Protein ID | WP_000233000.1 |
Coordinates | 1352472..1353341 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | OIY87_RS06845 | Protein ID | WP_044720927.1 |
Coordinates | 1353356..1353565 (-) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIY87_RS06810 (OIY87_08125) | 1347576..1348247 | - | 672 | WP_044720945.1 | Rep family protein | - |
OIY87_RS06815 (OIY87_08130) | 1348839..1349246 | - | 408 | WP_235809127.1 | hypothetical protein | - |
OIY87_RS06820 (OIY87_08135) | 1349675..1350412 | - | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
OIY87_RS06825 (OIY87_08140) | 1350537..1350620 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
OIY87_RS06830 (OIY87_08145) | 1350861..1351724 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
OIY87_RS06835 (OIY87_08150) | 1351757..1352491 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
OIY87_RS06840 (OIY87_08155) | 1352472..1353341 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
OIY87_RS06845 (OIY87_08160) | 1353356..1353565 | - | 210 | WP_044720927.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OIY87_RS06850 (OIY87_08165) | 1353887..1354690 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
OIY87_RS06855 (OIY87_08170) | 1354744..1356228 | - | 1485 | WP_044720925.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
OIY87_RS06860 (OIY87_08175) | 1356720..1358282 | - | 1563 | WP_269725228.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | tet(L) / tet(O/W/32/O) / erm(B) / ant(6)-Ia / lnu(B) / lsa(E) | - | 1331070..1361006 | 29936 | |
- | inside | IScluster/Tn | tet(L) / tet(O/W/32/O) / erm(B) / ant(6)-Ia / lnu(B) / lsa(E) | - | 1341473..1356228 | 14755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T266194 WP_000233000.1 NZ_CP113954:c1353341-1352472 [Streptococcus gallolyticus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|