Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 641563..642049 | Replicon | chromosome |
Accession | NZ_CP113954 | ||
Organism | Streptococcus gallolyticus strain XH2168 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1S5WAV3 |
Locus tag | OIY87_RS03475 | Protein ID | WP_009853752.1 |
Coordinates | 641780..642049 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | F5WZP8 |
Locus tag | OIY87_RS03470 | Protein ID | WP_013642845.1 |
Coordinates | 641563..641790 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIY87_RS03450 (OIY87_04755) | 637695..638009 | + | 315 | WP_003063779.1 | metalloregulator ArsR/SmtB family transcription factor | - |
OIY87_RS03455 (OIY87_04760) | 638012..639895 | + | 1884 | WP_269725183.1 | heavy metal translocating P-type ATPase | - |
OIY87_RS03460 (OIY87_04765) | 640055..640375 | + | 321 | WP_061458966.1 | multidrug efflux SMR transporter | - |
OIY87_RS03465 (OIY87_04770) | 640592..641284 | + | 693 | WP_009853732.1 | phosphoglycerate mutase | - |
OIY87_RS03470 (OIY87_04775) | 641563..641790 | + | 228 | WP_013642845.1 | DUF6290 family protein | Antitoxin |
OIY87_RS03475 (OIY87_04780) | 641780..642049 | + | 270 | WP_009853752.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OIY87_RS03480 (OIY87_04785) | 642428..642994 | - | 567 | WP_234756076.1 | DUF3267 domain-containing protein | - |
OIY87_RS03485 (OIY87_04790) | 643243..643764 | + | 522 | WP_009853754.1 | transcription repressor NadR | - |
OIY87_RS03490 (OIY87_04795) | 643961..644515 | + | 555 | WP_234756074.1 | hypothetical protein | - |
OIY87_RS03495 (OIY87_04800) | 644670..646823 | + | 2154 | WP_009853756.1 | penicillin-binding protein PBP2B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10554.64 Da Isoelectric Point: 10.4700
>T266192 WP_009853752.1 NZ_CP113954:641780-642049 [Streptococcus gallolyticus]
MTYRLVVSDKVKKQLKKMDKHVRLMLAKDMKKHLDGLENPRQIGKALIGQFKGLWRYRIGNYRVICDIMDDELVILAIEI
GHRKDIYKN
MTYRLVVSDKVKKQLKKMDKHVRLMLAKDMKKHLDGLENPRQIGKALIGQFKGLWRYRIGNYRVICDIMDDELVILAIEI
GHRKDIYKN
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S5WAV3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S5WAU8 |