Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1323530..1324063 | Replicon | chromosome |
| Accession | NZ_CP113946 | ||
| Organism | Lactobacillus sp. ESL0677 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZX76_RS06430 | Protein ID | WP_277164038.1 |
| Coordinates | 1323791..1324063 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OZX76_RS06425 | Protein ID | WP_277164037.1 |
| Coordinates | 1323530..1323787 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX76_RS06410 (OZX76_06410) | 1319075..1320037 | - | 963 | WP_277178823.1 | D-2-hydroxyacid dehydrogenase | - |
| OZX76_RS06415 (OZX76_06415) | 1320922..1322109 | + | 1188 | WP_277178825.1 | restriction endonuclease subunit S | - |
| OZX76_RS06420 (OZX76_06420) | 1322465..1323385 | - | 921 | WP_277178828.1 | site-specific integrase | - |
| OZX76_RS06425 (OZX76_06425) | 1323530..1323787 | + | 258 | WP_277164037.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX76_RS06430 (OZX76_06430) | 1323791..1324063 | + | 273 | WP_277164038.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX76_RS06435 (OZX76_06435) | 1324124..1325266 | - | 1143 | WP_277178830.1 | restriction endonuclease subunit S | - |
| OZX76_RS06440 (OZX76_06440) | 1325259..1326914 | - | 1656 | WP_277178832.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10505.31 Da Isoelectric Point: 9.9839
>T266185 WP_277164038.1 NZ_CP113946:1323791-1324063 [Lactobacillus sp. ESL0677]
MLNIKVTAKFRKDVKRCNKQGLPMTQLKLVIHELEQNHVLPSNYKNHALDGTYSNYLECHIKPDWLLIYQITQTTLALIR
TGSHAELFKK
MLNIKVTAKFRKDVKRCNKQGLPMTQLKLVIHELEQNHVLPSNYKNHALDGTYSNYLECHIKPDWLLIYQITQTTLALIR
TGSHAELFKK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|