Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1102986..1103519 | Replicon | chromosome |
| Accession | NZ_CP113945 | ||
| Organism | Lactobacillus sp. ESL0680 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZX58_RS05250 | Protein ID | WP_277140549.1 |
| Coordinates | 1103247..1103519 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OZX58_RS05245 | Protein ID | WP_277140548.1 |
| Coordinates | 1102986..1103243 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX58_RS05230 (OZX58_05230) | 1098614..1099576 | - | 963 | WP_277140545.1 | D-2-hydroxyacid dehydrogenase | - |
| OZX58_RS05235 (OZX58_05235) | 1100484..1101554 | + | 1071 | WP_277140546.1 | restriction endonuclease subunit S | - |
| OZX58_RS05240 (OZX58_05240) | 1101921..1102841 | - | 921 | WP_277140547.1 | site-specific integrase | - |
| OZX58_RS05245 (OZX58_05245) | 1102986..1103243 | + | 258 | WP_277140548.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX58_RS05250 (OZX58_05250) | 1103247..1103519 | + | 273 | WP_277140549.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX58_RS05255 (OZX58_05255) | 1103582..1104790 | - | 1209 | WP_277140550.1 | restriction endonuclease subunit S | - |
| OZX58_RS05260 (OZX58_05260) | 1104783..1106438 | - | 1656 | WP_277140551.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10535.34 Da Isoelectric Point: 10.0104
>T266184 WP_277140549.1 NZ_CP113945:1103247-1103519 [Lactobacillus sp. ESL0680]
MLNIKVTAKFRKDVKRCNRQGLPMTQLKLVIHELEQNHVLSSNYKNHALDGTYSNYLECHIKPDWLLIYQITQITLALIR
TGSHAELFKK
MLNIKVTAKFRKDVKRCNRQGLPMTQLKLVIHELEQNHVLSSNYKNHALDGTYSNYLECHIKPDWLLIYQITQITLALIR
TGSHAELFKK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|