Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 1486636..1487234 | Replicon | chromosome |
Accession | NZ_CP113943 | ||
Organism | Lactobacillus sp. ESL0681 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OZX59_RS07090 | Protein ID | WP_277125613.1 |
Coordinates | 1486893..1487234 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OZX59_RS07085 | Protein ID | WP_277125612.1 |
Coordinates | 1486636..1486899 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX59_RS07055 (OZX59_07055) | 1481662..1481922 | + | 261 | WP_277125601.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
OZX59_RS07060 (OZX59_07060) | 1481926..1482192 | + | 267 | WP_277125603.1 | type II toxin-antitoxin system YafQ family toxin | - |
OZX59_RS07065 (OZX59_07065) | 1482427..1483269 | + | 843 | WP_277125605.1 | hypothetical protein | - |
OZX59_RS07070 (OZX59_07070) | 1483515..1484000 | + | 486 | WP_277125606.1 | sigma-70 family RNA polymerase sigma factor | - |
OZX59_RS07075 (OZX59_07075) | 1484123..1485337 | + | 1215 | WP_277125608.1 | SLAP domain-containing protein | - |
OZX59_RS07080 (OZX59_07080) | 1485373..1486512 | + | 1140 | WP_277125611.1 | SLAP domain-containing protein | - |
OZX59_RS07085 (OZX59_07085) | 1486636..1486899 | + | 264 | WP_277125612.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OZX59_RS07090 (OZX59_07090) | 1486893..1487234 | + | 342 | WP_277125613.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OZX59_RS07095 (OZX59_07095) | 1487267..1487506 | - | 240 | WP_277125615.1 | hypothetical protein | - |
OZX59_RS07100 (OZX59_07100) | 1487865..1488869 | + | 1005 | WP_277125617.1 | tryptophan ABC transporter substrate-binding protein | - |
OZX59_RS07105 (OZX59_07105) | 1488866..1489768 | + | 903 | WP_277125619.1 | ABC transporter permease | - |
OZX59_RS07110 (OZX59_07110) | 1489758..1490525 | + | 768 | WP_277125621.1 | ATP-binding cassette domain-containing protein | - |
OZX59_RS07115 (OZX59_07115) | 1490655..1491257 | - | 603 | WP_277125623.1 | zeta toxin family protein | - |
OZX59_RS07120 (OZX59_07120) | 1491254..1491454 | - | 201 | WP_277125625.1 | hypothetical protein | - |
OZX59_RS07125 (OZX59_07125) | 1491717..1491998 | + | 282 | WP_277125628.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12779.67 Da Isoelectric Point: 6.7234
>T266183 WP_277125613.1 NZ_CP113943:1486893-1487234 [Lactobacillus sp. ESL0681]
MVKQGDIFYVDFKPSKGHEQINRRPAIALSHDLVQATSNMTIVAPISSTQRNFPMYHTLTSSQNVYGKVLLDQTIALDLQ
ARSITQNSIVDRVSKAELIEIIELYKLLFTVDE
MVKQGDIFYVDFKPSKGHEQINRRPAIALSHDLVQATSNMTIVAPISSTQRNFPMYHTLTSSQNVYGKVLLDQTIALDLQ
ARSITQNSIVDRVSKAELIEIIELYKLLFTVDE
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|