Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1481662..1482192 | Replicon | chromosome |
| Accession | NZ_CP113943 | ||
| Organism | Lactobacillus sp. ESL0681 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZX59_RS07060 | Protein ID | WP_277125603.1 |
| Coordinates | 1481926..1482192 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OZX59_RS07055 | Protein ID | WP_277125601.1 |
| Coordinates | 1481662..1481922 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX59_RS07045 (OZX59_07045) | 1476890..1479304 | + | 2415 | WP_277125597.1 | SLAP domain-containing protein | - |
| OZX59_RS07050 (OZX59_07050) | 1479662..1481491 | + | 1830 | WP_277125599.1 | SLAP domain-containing protein | - |
| OZX59_RS07055 (OZX59_07055) | 1481662..1481922 | + | 261 | WP_277125601.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX59_RS07060 (OZX59_07060) | 1481926..1482192 | + | 267 | WP_277125603.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX59_RS07065 (OZX59_07065) | 1482427..1483269 | + | 843 | WP_277125605.1 | hypothetical protein | - |
| OZX59_RS07070 (OZX59_07070) | 1483515..1484000 | + | 486 | WP_277125606.1 | sigma-70 family RNA polymerase sigma factor | - |
| OZX59_RS07075 (OZX59_07075) | 1484123..1485337 | + | 1215 | WP_277125608.1 | SLAP domain-containing protein | - |
| OZX59_RS07080 (OZX59_07080) | 1485373..1486512 | + | 1140 | WP_277125611.1 | SLAP domain-containing protein | - |
| OZX59_RS07085 (OZX59_07085) | 1486636..1486899 | + | 264 | WP_277125612.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10413.04 Da Isoelectric Point: 7.9271
>T266182 WP_277125603.1 NZ_CP113943:1481926-1482192 [Lactobacillus sp. ESL0681]
MFQIKATGKFKRDVKRCNKQGLEMDLLKKVVHELELGHELDRQYKNHGLSGNYDNFLECHIKPDWLLIYRVEQDTLILIR
TGSHADLF
MFQIKATGKFKRDVKRCNKQGLEMDLLKKVVHELELGHELDRQYKNHGLSGNYDNFLECHIKPDWLLIYRVEQDTLILIR
TGSHADLF
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|