Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09907-MazE
Location 1692844..1693442 Replicon chromosome
Accession NZ_CP113941
Organism Lactobacillus sp. ESL0684

Toxin (Protein)


Gene name pemK Uniprot ID -
Locus tag OZX56_RS08285 Protein ID WP_277125613.1
Coordinates 1692844..1693185 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag OZX56_RS08290 Protein ID WP_277125612.1
Coordinates 1693179..1693442 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZX56_RS08250 (OZX56_08250) 1688080..1688361 - 282 WP_277139550.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
OZX56_RS08255 (OZX56_08255) 1688624..1688824 + 201 WP_277125625.1 hypothetical protein -
OZX56_RS08260 (OZX56_08260) 1688821..1689423 + 603 WP_277125623.1 zeta toxin family protein -
OZX56_RS08265 (OZX56_08265) 1689553..1690320 - 768 WP_277125621.1 ATP-binding cassette domain-containing protein -
OZX56_RS08270 (OZX56_08270) 1690310..1691212 - 903 WP_277125619.1 ABC transporter permease -
OZX56_RS08275 (OZX56_08275) 1691209..1692213 - 1005 WP_277139551.1 tryptophan ABC transporter substrate-binding protein -
OZX56_RS08280 (OZX56_08280) 1692572..1692811 + 240 WP_277125615.1 hypothetical protein -
OZX56_RS08285 (OZX56_08285) 1692844..1693185 - 342 WP_277125613.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OZX56_RS08290 (OZX56_08290) 1693179..1693442 - 264 WP_277125612.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
OZX56_RS08295 (OZX56_08295) 1693566..1694705 - 1140 WP_277139552.1 SLAP domain-containing protein -
OZX56_RS08300 (OZX56_08300) 1694741..1695955 - 1215 WP_277139553.1 SLAP domain-containing protein -
OZX56_RS08305 (OZX56_08305) 1696078..1696563 - 486 WP_277139554.1 sigma-70 family RNA polymerase sigma factor -
OZX56_RS08310 (OZX56_08310) 1696810..1697232 - 423 WP_277139555.1 hypothetical protein -
OZX56_RS08315 (OZX56_08315) 1697239..1697652 - 414 WP_277139556.1 hypothetical protein -
OZX56_RS08320 (OZX56_08320) 1697886..1698151 - 266 Protein_1594 type II toxin-antitoxin system YafQ family toxin -
OZX56_RS08325 (OZX56_08325) 1698155..1698415 - 261 WP_277125601.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-101)

Antitoxin

SpoVT-AbrB domain

(12-52)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12779.67 Da        Isoelectric Point: 6.7234

>T266178 WP_277125613.1 NZ_CP113941:c1693185-1692844 [Lactobacillus sp. ESL0684]
MVKQGDIFYVDFKPSKGHEQINRRPAIALSHDLVQATSNMTIVAPISSTQRNFPMYHTLTSSQNVYGKVLLDQTIALDLQ
ARSITQNSIVDRVSKAELIEIIELYKLLFTVDE

Download         Length: 342 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9963.18 Da        Isoelectric Point: 6.2195

>AT266178 WP_277125612.1 NZ_CP113941:c1693442-1693179 [Lactobacillus sp. ESL0684]
MTAIIGKTRIAQWGNSKATRIPNNIVKQLHLKENQSLTITLKDNSIVLTPEEKQPKNIHELFANWQDDGQRAEELDWGTS
SGHELEW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References