Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 1227273..1227926 Replicon chromosome
Accession NZ_CP113941
Organism Lactobacillus sp. ESL0684

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OZX56_RS05960 Protein ID WP_277139266.1
Coordinates 1227735..1227926 (-) Length 64 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OZX56_RS05955 Protein ID WP_277139265.1
Coordinates 1227273..1227677 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZX56_RS05925 (OZX56_05925) 1223300..1223923 - 624 WP_277139259.1 ABC transporter ATP-binding protein -
OZX56_RS05930 (OZX56_05930) 1223943..1225091 - 1149 WP_277139260.1 hypothetical protein -
OZX56_RS05935 (OZX56_05935) 1225163..1225489 - 327 WP_277139261.1 hypothetical protein -
OZX56_RS05940 (OZX56_05940) 1225778..1226608 + 831 WP_277139262.1 helix-turn-helix transcriptional regulator -
OZX56_RS05945 (OZX56_05945) 1226661..1226951 + 291 WP_277139263.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OZX56_RS05950 (OZX56_05950) 1226944..1227213 + 270 WP_277139264.1 Txe/YoeB family addiction module toxin -
OZX56_RS05955 (OZX56_05955) 1227273..1227677 - 405 WP_277139265.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OZX56_RS05960 (OZX56_05960) 1227735..1227926 - 192 WP_277139266.1 type II toxin-antitoxin system HicA family toxin Toxin
OZX56_RS05965 (OZX56_05965) 1228196..1228951 - 756 WP_277139267.1 triose-phosphate isomerase -
OZX56_RS05970 (OZX56_05970) 1228973..1230184 - 1212 WP_277139268.1 phosphoglycerate kinase -
OZX56_RS05975 (OZX56_05975) 1230289..1231305 - 1017 WP_277126223.1 type I glyceraldehyde-3-phosphate dehydrogenase -
OZX56_RS05980 (OZX56_05980) 1231367..1232398 - 1032 WP_277139269.1 sugar-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(11-128)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7119.29 Da        Isoelectric Point: 10.6734

>T266177 WP_277139266.1 NZ_CP113941:c1227926-1227735 [Lactobacillus sp. ESL0684]
MPLTGKDMLKLLLDNGWIERRVAGSHHHLYKNGVRITIPVHGNQDLGNGLERKILKEAGLTRH

Download         Length: 192 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14783.95 Da        Isoelectric Point: 5.1598

>AT266177 WP_277139265.1 NZ_CP113941:c1227677-1227273 [Lactobacillus sp. ESL0684]
MSKTSDLFLVYPAVFTPEAKGGYLIEFPDIQGAFTGINTDDISYGIAMAEEALGLTLADYIENADSVNPPSNINEVKVPE
NAFVTLIKTNVSKYLNNDKLVKKTLTIPQWADRKAKKQKLNFSALLTNAILQQK

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References