Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 21337..21925 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP113936 | ||
| Organism | Acinetobacter sp. ESL0695 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZX61_RS12585 | Protein ID | WP_191103926.1 |
| Coordinates | 21629..21925 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OZX61_RS12580 | Protein ID | WP_191103925.1 |
| Coordinates | 21337..21627 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX61_RS12555 (OZX61_12555) | 16821..17459 | - | 639 | WP_277095787.1 | hypothetical protein | - |
| OZX61_RS12560 (OZX61_12560) | 17449..18852 | - | 1404 | WP_277095788.1 | AAA family ATPase | - |
| OZX61_RS12565 (OZX61_12565) | 19485..20090 | - | 606 | WP_277095769.1 | DUF4326 domain-containing protein | - |
| OZX61_RS12570 (OZX61_12570) | 20093..20533 | - | 441 | WP_277095770.1 | DUF488 domain-containing protein | - |
| OZX61_RS12575 (OZX61_12575) | 20547..21188 | - | 642 | WP_277095771.1 | hypothetical protein | - |
| OZX61_RS12580 (OZX61_12580) | 21337..21627 | - | 291 | WP_191103925.1 | putative addiction module antidote protein | Antitoxin |
| OZX61_RS12585 (OZX61_12585) | 21629..21925 | - | 297 | WP_191103926.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OZX61_RS12590 (OZX61_12590) | 22428..22550 | - | 123 | WP_277095789.1 | hypothetical protein | - |
| OZX61_RS12595 (OZX61_12595) | 23110..23682 | - | 573 | WP_277095772.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..34963 | 34963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11554.31 Da Isoelectric Point: 8.5275
>T266173 WP_191103926.1 NZ_CP113936:c21925-21629 [Acinetobacter sp. ESL0695]
MIEIKRLPEFDEWLDGLKDNMTRIRLNRRLDKVQRGNWGDIKPLQEGVWEMREFFGAGWRMYYIQHGDVVIVMLGGGEKS
TQSKDIDRAVKLSKTLEN
MIEIKRLPEFDEWLDGLKDNMTRIRLNRRLDKVQRGNWGDIKPLQEGVWEMREFFGAGWRMYYIQHGDVVIVMLGGGEKS
TQSKDIDRAVKLSKTLEN
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|