Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 43484..44012 | Replicon | plasmid unnamed4 |
Accession | NZ_CP113935 | ||
Organism | Acinetobacter sp. ESL0695 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OZX61_RS12295 | Protein ID | WP_277095764.1 |
Coordinates | 43484..43777 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OZX61_RS12300 | Protein ID | WP_277095765.1 |
Coordinates | 43767..44012 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX61_RS12265 (OZX61_12265) | 39384..40073 | + | 690 | WP_277095759.1 | hypothetical protein | - |
OZX61_RS12270 (OZX61_12270) | 40235..40378 | + | 144 | Protein_34 | RepB family plasmid replication initiator protein | - |
OZX61_RS12275 (OZX61_12275) | 40397..41242 | - | 846 | WP_277095760.1 | nitroreductase family protein | - |
OZX61_RS12280 (OZX61_12280) | 41379..42278 | + | 900 | WP_277095761.1 | LysR family transcriptional regulator | - |
OZX61_RS12285 (OZX61_12285) | 42384..42767 | - | 384 | WP_277095762.1 | VOC family protein | - |
OZX61_RS12290 (OZX61_12290) | 42904..43410 | - | 507 | WP_277095763.1 | hypothetical protein | - |
OZX61_RS12295 (OZX61_12295) | 43484..43777 | - | 294 | WP_277095764.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZX61_RS12300 (OZX61_12300) | 43767..44012 | - | 246 | WP_277095765.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OZX61_RS12305 (OZX61_12305) | 44559..44885 | - | 327 | WP_277095766.1 | hypothetical protein | - |
OZX61_RS12310 (OZX61_12310) | 45125..45256 | + | 132 | WP_277095767.1 | hypothetical protein | - |
OZX61_RS12315 (OZX61_12315) | 45633..46433 | + | 801 | WP_277095705.1 | hypothetical protein | - |
OZX61_RS12320 (OZX61_12320) | 46559..46704 | - | 146 | Protein_44 | transcriptional regulator | - |
OZX61_RS12325 (OZX61_12325) | 46967..48109 | - | 1143 | WP_277095706.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..90863 | 90863 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11212.30 Da Isoelectric Point: 10.5837
>T266172 WP_277095764.1 NZ_CP113935:c43777-43484 [Acinetobacter sp. ESL0695]
MTYKLLRHKDFASEWENLPSAIRDQLKKKLSKIIQQPHVPKNILRGDLAGCYKIKLLKAGVRLVYQVRDDQVIILLITVG
KRADNIVYNEAKKRIGD
MTYKLLRHKDFASEWENLPSAIRDQLKKKLSKIIQQPHVPKNILRGDLAGCYKIKLLKAGVRLVYQVRDDQVIILLITVG
KRADNIVYNEAKKRIGD
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|